| IED ID | IndEnz0002019054 | 
| Enzyme Type ID | protease019054 | 
| Protein Name | 
                        
                            
                                Thiol protease aleurain  AtALEU EC 3.4.22.16 Senescence-associated gene product 2  | 
                    
| Gene Name | ALEU AALP SAG2 At5g60360 MUF9.1 | 
| Organism | Arabidopsis thaliana (Mouse-ear cress) | 
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) | 
| Enzyme Sequence | MSAKTILSSVVLVVLVAASAAANIGFDESNPIRMVSDGLREVEESVSQILGQSRHVLSFARFTHRYGKKYQNVEEMKLRFSIFKENLDLIRSTNKKGLSYKLGVNQFADLTWQEFQRTKLGAAQNCSATLKGSHKVTEAALPETKDWREDGIVSPVKDQGGCGSCWTFSTTGALEAAYHQAFGKGISLSEQQLVDCAGAFNNYGCNGGLPSQAFEYIKSNGGLDTEKAYPYTGKDETCKFSAENVGVQVLNSVNITLGAEDELKHAVGLVRPVSIAFEVIHSFRLYKSGVYTDSHCGSTPMDVNHAVLAVGYGVEDGVPYWLIKNSWGADWGDKGYFKMEMGKNMCGIATCASYPVVA | 
| Enzyme Length | 358 | 
| Uniprot Accession Number | Q8H166 | 
| Absorption | |
| Active Site | ACT_SITE 165; /evidence=ECO:0000250; ACT_SITE 305; /evidence=ECO:0000250; ACT_SITE 325; /evidence=ECO:0000250 | 
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of proteins, acting as an aminopeptidase (notably, cleaving Arg-|-Xaa bonds) as well as an endopeptidase.; EC=3.4.22.16; | 
| DNA Binding | |
| EC Number | 3.4.22.16 | 
| Enzyme Function | FUNCTION: May play a role in proteolysis leading to mobilization of nitrogen during senescence and starvation. | 
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (3); Glycosylation (2); Propeptide (1); Region (1); Sequence conflict (4); Signal peptide (1) | 
| Keywords | Alternative splicing;Disulfide bond;Glycoprotein;Hydrolase;Protease;Reference proteome;Signal;Thiol protease;Vacuole;Zymogen | 
| Interact With | |
| Induction | INDUCTION: Induced during senescence. Strongly induced by ethylene and slightly by abscisic acid. Repressed by cytokinin and darkness. Seems to be not affected by dehydration. {ECO:0000269|PubMed:14617064, ECO:0000269|PubMed:8518555, ECO:0000269|PubMed:9617813}. | 
| Subcellular Location | SUBCELLULAR LOCATION: Vacuole {ECO:0000269|PubMed:10871276, ECO:0000269|PubMed:12730271}. Note=Predominantly vacuolar. From the Golgi apparatus, transported to the lytic vacuole (LV) in clathrin-coated vesicles (CCVs) via the prevacuolar compartment (PVC). In root elongating cells and stomata, localized in central vacuole and in small compartments (LVs, PVCs, Golgi bodies or small vacuoles). Limited to central vacuole in root elongated cells, leaf epidermal cells and trichomes of the lower face of the leaf blade. Limited to small compartments in root cap and apex cells, hypocotyl parenchyma cells and trichomes of the upper face of the leaf blade. | 
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..21; /evidence=ECO:0000255 | 
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | 14749481; 15352244; | 
| Motif | |
| Gene Encoded By | |
| Mass | 38,959 | 
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |