| IED ID | IndEnz0002019162 |
| Enzyme Type ID | protease019162 |
| Protein Name |
CD70 antigen CD27 ligand CD27-L Tumor necrosis factor ligand superfamily member 7 CD antigen CD70 |
| Gene Name | Cd70 Cd27l Cd27lg Tnfsf7 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MPEEGRPCPWVRWSGTAFQRQWPWLLLVVFITVFCCWFHCSGLLSKQQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP |
| Enzyme Length | 195 |
| Uniprot Accession Number | O55237 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Cytokine which is the ligand for CD27. The CD70-CD27 pathway plays an important role in the generation and maintenance of T cell immunity, in particular during antiviral responses. Upon CD27 binding, induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells. {ECO:0000269|PubMed:9620608}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Glycosylation (3); Topological domain (2); Transmembrane (1) |
| Keywords | Cytokine;Disulfide bond;Glycoprotein;Membrane;Reference proteome;Signal-anchor;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | INDUCTION: By IL-2 and concanavalin A (Con A). |
| Subcellular Location | SUBCELLULAR LOCATION: Membrane {ECO:0000250|UniProtKB:P32970}; Single-pass type II membrane protein {ECO:0000255}. |
| Modified Residue | |
| Post Translational Modification | PTM: N-glycosylated. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11239407; 11728341; 11739537; 12469117; 12860530; 15128787; 15170228; 15226368; 15557144; 15661893; 15937486; 16920932; 17237405; 17295392; 17438065; 18292513; 18354184; 19062317; 19279334; 19380782; 19710474; 19864607; 19952354; 20354106; 20505312; 20639485; 21267068; 21490618; 22450812; 22499851; 22798683; 23137837; 23159439; 23269247; 23547099; 23832783; 23913967; 24913981; 25787857; 26179759; 26263500; 26461455; 26988069; 27569212; 28341747; 28550198; 29046346; 31263704; 32868408; |
| Motif | |
| Gene Encoded By | |
| Mass | 21,919 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |