| IED ID | IndEnz0002019199 |
| Enzyme Type ID | protease019199 |
| Protein Name |
ATP synthase subunit e, mitochondrial ATPase subunit e ATP synthase membrane subunit e Cleaved into: ATP synthase subunit e, mitochondrial, N-terminally processed |
| Gene Name | ATP5ME ATP5I ATP5K |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK |
| Enzyme Length | 69 |
| Uniprot Accession Number | P56385 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (2); Initiator methionine (1); Modified residue (2) |
| Keywords | ATP synthesis;Acetylation;CF(0);Direct protein sequencing;Hydrogen ion transport;Ion transport;Membrane;Mitochondrion;Mitochondrion inner membrane;Phosphoprotein;Reference proteome;Transport |
| Interact With | Q9UHD4; Q9NZD8 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion. Mitochondrion inner membrane. |
| Modified Residue | MOD_RES 34; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:Q06185; MOD_RES 66; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P29419 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11939412; 16682002; 17121862; 18060860; 18323778; 19167051; 19688755; 20195357; 20833715; 20877624; 21836051; 21874239; 22623428; 22864911; 24098383; 24344204; 25285856; 25561175; 25852190; 26496610; 4517936; |
| Motif | |
| Gene Encoded By | |
| Mass | 7,933 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |