| IED ID | IndEnz0002019219 |
| Enzyme Type ID | protease019219 |
| Protein Name |
Ecotin-like protein 1 Inhibitor of serine peptidase 1 LmISP1 |
| Gene Name | ISP1 LmjF15.0300 LmjF_15_0300 |
| Organism | Leishmania major |
| Taxonomic Lineage | cellular organisms Eukaryota Discoba Euglenozoa Kinetoplastea (kinetoplasts) Metakinetoplastina Trypanosomatida Trypanosomatidae Leishmaniinae Leishmania Leishmania Leishmania major species complex Leishmania major |
| Enzyme Sequence | MSYCKIEAPYPEAEAGEKRIIFALDPKGDEVEQEQCMLQLIPGRVLEMSRNDAANHQTLGGSIEQHTVEGFGAKFFHVKLAKQAVSTLMYVHAEDHGEKVRKFVAMSNAPMFPYRSRYPVVVYLPKDAELRYGIWCGGQQMQAATE |
| Enzyme Length | 146 |
| Uniprot Accession Number | Q4QFF0 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1) |
| Keywords | Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 16,454 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |