| IED ID | IndEnz0002019287 |
| Enzyme Type ID | protease019287 |
| Protein Name |
Carboxyl-terminal-processing protease EC 3.4.21.102 CtpA |
| Gene Name | ctpA SYNPCC7002_A0843 |
| Organism | Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Cyanobacteria/Melainabacteria group Cyanobacteria Synechococcales Synechococcaceae Synechococcus unclassified Synechococcus Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) (Agmenellum quadruplicatum) |
| Enzyme Sequence | MLRKRLQAGLCSLLLVLVLVFGPMERAIAFTDEQDLLLQAWRYVSQAYVDETFNHQNWWLIRQKFLKRPLKTRDEAYEAVGEMLALLDDPYTRLLRPEQYRSLKVSTSGELSGVGLQINVNPEVDVLEVILPLPGSPAEAAGIEAKDQILAIDGIDTRNIGLEEAAARMRGKKGSTVSLTVKSPKTDTVRTVKVTRDTIALNPVYDKLDEKNGEKVGYIRLNQFSANAKTEIIKSLNQLQKQGADRYVLDLRNNPGGLLQAGIEIARLWLDQETIVYTVNRQGIFESYSAVGQPLTDAPLVVLVNQATASASEILAGALQDNGRAMLVGEKTFGKGLIQSLFELPDGAGMAVTVAKYETPLHHDINKLGIMPDEVVPQEPIGYAMMGSETDLQYQAALDLLTQDQAIAQISQAS |
| Enzyme Length | 414 |
| Uniprot Accession Number | P42784 |
| Absorption | |
| Active Site | ACT_SITE 310; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 321; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 335; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=The enzyme shows specific recognition of a C-terminal tripeptide, Xaa-Yaa-Zaa, in which Xaa is preferably Ala or Leu, Yaa is preferably Ala or Tyr, and Zaa is preferably Ala, but then cleaves at a variable distance from the C-terminus. A typical cleavage is -Ala-Ala-|-Arg-Ala-Ala-Lys-Glu-Asn-Tyr-Ala-Leu-Ala-Ala.; EC=3.4.21.102; |
| DNA Binding | |
| EC Number | 3.4.21.102 |
| Enzyme Function | FUNCTION: Cleavage of the 16 C-terminal residues from the D1 precursor of photosystem II (PSII). This proteolytic processing is necessary to allow the light-driven assembly of the oxygen-evolving cluster (a tetranuclear manganese), which is responsible for photosynthetic water oxidation. {ECO:0000250|UniProtKB:Q55669}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Domain (1); Frameshift (1); Signal peptide (1) |
| Keywords | Hydrolase;Protease;Reference proteome;Serine protease;Signal;Thylakoid |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cellular thylakoid lumen {ECO:0000250|UniProtKB:O04073}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..29; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 45,575 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |