| IED ID | IndEnz0002019290 |
| Enzyme Type ID | protease019290 |
| Protein Name |
Cold shock-like protein CspD CSP-D |
| Gene Name | cspD cspH ybjA b0880 JW0864 |
| Organism | Escherichia coli (strain K12) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli (strain K12) |
| Enzyme Sequence | MEKGTVKWFNNAKGFGFICPEGGGEDIFAHYSTIQMDGYRTLKAGQSVQFDVHQGPKGNHASVIVPVEVEAAVA |
| Enzyme Length | 74 |
| Uniprot Accession Number | P0A968 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits DNA replication at both initiation and elongation steps, most probably by binding to the opened, single-stranded regions at replication forks. Plays a regulatory role in chromosomal replication in nutrient-depleted cells.; FUNCTION: Involved in persister cell formation, acting downstream of mRNA interferase (toxin) MqsR. Overproduction is toxic. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Sequence conflict (1) |
| Keywords | Cytoplasm;DNA replication inhibitor;DNA-binding;Direct protein sequencing;RNA-binding;Reference proteome;Toxin |
| Interact With | P0AAG0 |
| Induction | INDUCTION: Not induced by cold-shock. Stationary-phase and starvation inducible, as well as by oxidative stress (30 mM H(2)O(2)). Repressed by MqsA and MqsRA toxin-antitoxin system. {ECO:0000269|PubMed:20105222}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 15690043; 16606699; 24561554; |
| Motif | |
| Gene Encoded By | |
| Mass | 7,969 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |