| IED ID | IndEnz0002019374 |
| Enzyme Type ID | protease019374 |
| Protein Name |
Cysteine protease inhibitor 7 PCPI-7 Pcpi7 Fragment |
| Gene Name | |
| Organism | Solanum tuberosum (Potato) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Solanoideae Solaneae Solanum Solanum tuberosum (Potato) |
| Enzyme Sequence | VLPEVYDQDGEPLRIGERYIIKNPLLGGGAVYLYNIGNLQCPNAVLQHMSIPQFLGKGTPVVFVRKSESDYGDVVRVMTGVYIKFFFKTSKLCVDETVWKVNDEELVVTGGNVGNENDIFKIKKTDLVIRGMKNVYKLLHCRSHLGCKNIGGNFKNGYPRLAAVDDDKDFIPFVFIKA |
| Enzyme Length | 178 |
| Uniprot Accession Number | O24385 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibitor of cysteine proteases. May protect the plant by inhibiting proteases of invading organisms. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Non-terminal residue (1) |
| Keywords | Disulfide bond;Protease inhibitor;Reference proteome;Thiol protease inhibitor;Vacuole |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Vacuole {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 19,977 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |