| IED ID | IndEnz0002019384 |
| Enzyme Type ID | protease019384 |
| Protein Name |
Short tail fiber protein gp12 Gene product 12 gp12 |
| Gene Name | 12 |
| Organism | Enterobacteria phage T4 (Bacteriophage T4) |
| Taxonomic Lineage | Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes Caudovirales Myoviridae (phages with contractile tails) Tevenvirinae Tequatrovirus Enterobacteria phage T4 (Bacteriophage T4) |
| Enzyme Sequence | MSNNTYQHVSNESRYVKFDPTDTNFPPEITDVQAAIAAISPAGVNGVPDASSTTKGILFIPTEQEVIDGTNNTKAVTPATLATRLSYPNATETVYGLTRYSTNDEAIAGVNNESSITPAKFTVALNNAFETRVSTESSNGVIKISSLPQALAGADDTTAMTPLKTQQLAIKLIAQIAPSETTATESDQGVVQLATVAQVRQGTLREGYAISPYTFMNSSSTEEYKGVIKLGTQSEVNSNNASVAVTGATLNGRGSTTSMRGVVKLTTTAGSQSGGDASSALAWNADVIQQRGGQIIYGTLRIEDTFTIANGGANITGTVRMTGGYIQGNRIVTQNEIDRTIPVGAIMMWAADSLPSDAWRFCHGGTVSASDCPLYASRIGTRYGGNPSNPGLPDMRGLFVRGSGRGSHLTNPNVNGNDQFGKPRLGVGCTGGYVGEVQIQQMSYHKHAGGFGEHDDLGAFGNTRRSNFVGTRKGLDWDNRSYFTNDGYEIDPESQRNSKYTLNRPELIGNETRPWNISLNYIIKVKE |
| Enzyme Length | 527 |
| Uniprot Accession Number | P10930 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Structural component of the short tail fiber. Adhesion protein that binds irreversibly to the lipopolysaccharides component (LPS) on the cell surface of Escherichia coli B strains during virus attachment. After at least three long tail fibers have bound, short tail fibers extend and bind irreversibly to the core region of the host cell LPS. {ECO:0000269|PubMed:12837775, ECO:0000269|PubMed:27193680}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (11); Chain (1); Helix (7); Sequence conflict (2); Turn (3) |
| Keywords | 3D-structure;Host-virus interaction;Late protein;Reference proteome;Viral attachment to host cell;Viral attachment to host entry receptor;Viral tail fiber protein;Viral tail protein;Virion;Virus entry into host cell |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Virion {ECO:0000269|PubMed:27193680}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | Electron microscopy (2); X-ray crystallography (2) |
| Cross Reference PDB | 1H6W; 1OCY; 1PDI; 5IV5; |
| Mapped Pubmed ID | 10504409; 10782996; 11530935; 12888344; 12923574; |
| Motif | |
| Gene Encoded By | |
| Mass | 56,205 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |