| IED ID | IndEnz0002019393 |
| Enzyme Type ID | protease019393 |
| Protein Name |
Defensin-like protein 3 Small protein inhibitor of insect alpha-amylases 3 SI alpha-3 |
| Gene Name | |
| Organism | Sorghum bicolor (Sorghum) (Sorghum vulgare) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae PACMAD clade Panicoideae Andropogonodae Andropogoneae Sorghinae Sorghum Sorghum bicolor (Sorghum) (Sorghum vulgare) |
| Enzyme Sequence | RVCRRRSAGFKGLCMSDHNCAQVCLQEGWGGGNCDGVIRQCKCIRQC |
| Enzyme Length | 47 |
| Uniprot Accession Number | P21925 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (4); Sequence conflict (1) |
| Keywords | Antimicrobial;Direct protein sequencing;Disulfide bond;Fungicide;Plant defense |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 5,204 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |