| IED ID | IndEnz0002019397 |
| Enzyme Type ID | protease019397 |
| Protein Name |
Eppin Epididymal protease inhibitor Serine protease inhibitor-like with Kunitz and WAP domains 1 |
| Gene Name | Eppin Spinlw1 |
| Organism | Rattus norvegicus (Rat) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
| Enzyme Sequence | MKFSRFVSILVLFGLLTKVQGPSLTDFLFPRRCPRFREECEHRERDLCTRDRDCQKREKCCIFSCGKKCLNPQQDICSLPKDSGYCMAYFPRWWYNKKNGTCQLFIYGGCQGNNNNFQSQSICQNACEKKSNST |
| Enzyme Length | 134 |
| Uniprot Accession Number | D4A2Z2 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Serine protease inhibitor that plays an essential role in male reproduction and fertility. Modulates the hydrolysis of SEMG1 by KLK3/PSA (a serine protease), provides antimicrobial protection for spermatozoa in the ejaculate coagulum, and binds SEMG1 thereby inhibiting sperm motility (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (7); Domain (2); Region (2); Signal peptide (1) |
| Keywords | Antimicrobial;Disulfide bond;Protease inhibitor;Reference proteome;Repeat;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..21; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 15,684 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |