| IED ID | IndEnz0003000062 |
| Enzyme Type ID | pectinase000062 |
| Protein Name |
Exopolygalacturonase ExoPG EC 3.2.1.67 Galacturan 1,4-alpha-galacturonidase Pectinase Fragment |
| Gene Name | |
| Organism | Oenothera organensis (Evening primrose) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Myrtales Onagraceae Onagroideae Onagreae Oenothera (evening primroses) Oenothera organensis (Evening primrose) |
| Enzyme Sequence | DSTQALTTAWKEACASASPSTILVPKGNFAVGLITLEGPCKSSIGLQLQGTLKAPADPSKIKGLGWINLNKIDLLTIFGGGVFDGQGKSAWVQNDCHKNGPICKTLSMNLRLYAVTNSILRDVTTLDSKNFHVNVIGCKNLTFERFKISAAETSINTDGIHIGRSDGVNIINTEIKTGDDCISLGDGSKNINITNITCGPGHGISVGSLGRYKNEESVVGIYVKNCTITGSQNGVRIKTWPKSEPGEASEMHFQDITMNSVGTPILIDQGYCPYNQCTAEVPSSVKLSKISFKNIKGTSTTKEAVKLVCSKSFPCNGVELADIDLTYSGKGGPATSVCENIKPTIKGKQIPAICSGSAAKAA |
| Enzyme Length | 362 |
| Uniprot Accession Number | P24548 |
| Absorption | |
| Active Site | ACT_SITE 179; /note=Proton donor; /evidence=ECO:0000255|PROSITE-ProRule:PRU10052; ACT_SITE 202; /evidence=ECO:0000255|PROSITE-ProRule:PRU10052 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[(1->4)-alpha-D-galacturonosyl](n) + H2O = [(1->4)-alpha-D-galacturonosyl](n-1) + alpha-D-galacturonate; Xref=Rhea:RHEA:14117, Rhea:RHEA-COMP:14570, Rhea:RHEA-COMP:14572, ChEBI:CHEBI:15377, ChEBI:CHEBI:58658, ChEBI:CHEBI:140523; EC=3.2.1.67; |
| DNA Binding | |
| EC Number | 3.2.1.67 |
| Enzyme Function | FUNCTION: May function in depolymerizing pectin during pollen development, germination, and tube growth. Acts as an exo-polygalacturonase. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Glycosylation (4); Non-terminal residue (1); Repeat (4) |
| Keywords | Cell wall;Cell wall biogenesis/degradation;Glycoprotein;Glycosidase;Hydrolase;Repeat;Secreted |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. Secreted, cell wall {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 38,207 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:14117 |
| Cross Reference Brenda |