| IED ID | IndEnz0003000067 |
| Enzyme Type ID | pectinase000067 |
| Protein Name |
Polygalacturonase EC 3.2.1.15 PGL Pectinase |
| Gene Name | pgl |
| Organism | Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Alphaproteobacteria Hyphomicrobiales Rhizobiaceae Rhizobium/Agrobacterium group Agrobacterium Agrobacterium tumefaciens complex Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) |
| Enzyme Sequence | MALATRATGGAGRRKPVRARCARGLHLVSCHKTQLLGFTIRNAASWTIHPQGCEDLTAAASTIIAPHDSPNTDGFNPESCRNVMISGVRFSVGDDCIAVKAGKRGPDGEDDHLAETRGITVRHCLMQPGHGGLVIGSEMSGGVHDVTVEDCDMIGTDRGLRLKTGARSGGGMVGNITMRRVLLDGVQTALSANAHYHCDADGHDDWVQSRNPAPVNDGTPFVDGITVEDVEIRNLAHAAGVFLGLPDVPSATSLSATSPIVSHDPSAVATPPIMADRVRPMRMRLVFEQADVVCDDPALLNDAPVSISSYFD |
| Enzyme Length | 312 |
| Uniprot Accession Number | P27644 |
| Absorption | |
| Active Site | ACT_SITE 94; /note=Proton donor; /evidence=ECO:0000250|UniProtKB:O74213; ACT_SITE 130; /evidence=ECO:0000255|PROSITE-ProRule:PRU10052 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=(1,4-alpha-D-galacturonosyl)(n+m) + H(2)O = (1,4-alpha-D-galacturonosyl)(n) + (1,4-alpha-D-galacturonosyl)(m).; EC=3.2.1.15; |
| DNA Binding | |
| EC Number | 3.2.1.15 |
| Enzyme Function | FUNCTION: Seems to regulate the surface properties of the bacterium in the presence of plant cells or plant cell extracts. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Repeat (4) |
| Keywords | Cell wall biogenesis/degradation;Glycosidase;Hydrolase;Repeat;Secreted |
| Interact With | |
| Induction | INDUCTION: By certain acidic polysaccharides found in carrot root extract. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 32,943 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |