| IED ID |
IndEnz0003000079 |
| Enzyme Type ID |
pectinase000079 |
| Protein Name |
Pectin degradation repressor protein KdgR
|
| Gene Name |
kdgR |
| Organism |
Dickeya chrysanthemi (Pectobacterium chrysanthemi) (Erwinia chrysanthemi) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Proteobacteria
Gammaproteobacteria
Enterobacterales
Pectobacteriaceae
Dickeya
Dickeya chrysanthemi (Pectobacterium chrysanthemi) (Erwinia chrysanthemi)
|
| Enzyme Sequence |
MIFNRSVTYSNARLPYSKRSLYTKTRVLFFLKQKILSRVTTKMAIADLDKQPDSVSSVLKVFGILQALGEEREIGITELSQRVMMSKSTVYRFLQTMKSLGYVAQEGESEKYSLTLKLFELGAKALQNVDLIRSADIQMRELSALTRETIHLGALDEDSIVYIHKIDSMYNLRMYSRIGRRNPLHSTAIGKVLLAWRDREEVKEILSQVEFKRTTVHTIGSTEELLPQLDLVRQQGYGEDNEEQEEGLRCIAVPVFDRFGVVIAGLSISFPTIRFSEDNKHEYVAMLHTAARNISDQMGYHDYPF |
| Enzyme Length |
305 |
| Uniprot Accession Number |
P37728 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
DNA_BIND 76..95; /note=H-T-H motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU00393 |
| EC Number |
|
| Enzyme Function |
FUNCTION: Transcriptional repressor of genes involved in pectinolysis and in pectinase secretion. Controls all the genes involved in pectin catabolism, including the pel genes encoding pectate lyases, KdgT which encodes the 2-keto-3-deoxygluconate transport system and KdgK which encodes the kdg kinase. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); DNA binding (1); Domain (2) |
| Keywords |
DNA-binding;Repressor;Transcription;Transcription regulation |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
34,960 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|