| IED ID | IndEnz0004000028 |
| Enzyme Type ID | xylanase000028 |
| Protein Name |
Glycerol-3-phosphate acyltransferase Acyl-PO4 G3P acyltransferase Acyl-phosphate--glycerol-3-phosphate acyltransferase G3P acyltransferase GPAT EC 2.3.1.275 Lysophosphatidic acid synthase LPA synthase |
| Gene Name | plsY yneS BSU18070 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MLIALLIILAYLIGSIPSGLIVGKLAKGIDIREHGSGNLGATNAFRTLGVKAGSVVIAGDILKGTLATALPFLMHVDIHPLLAGVFAVLGHVFPIFAKFKGGKAVATSGGVLLFYAPLLFITMVAVFFIFLYLTKFVSLSSMLTGIYTVIYSFFVHDTYLLIVVTLLTIFVIYRHRANIKRIINKTEPKVKWL |
| Enzyme Length | 193 |
| Uniprot Accession Number | Q45064 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by acyl-CoA. {ECO:0000269|PubMed:17557823}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=an acyl phosphate + sn-glycerol 3-phosphate = a 1-acyl-sn-glycero-3-phosphate + phosphate; Xref=Rhea:RHEA:34075, ChEBI:CHEBI:43474, ChEBI:CHEBI:57597, ChEBI:CHEBI:57970, ChEBI:CHEBI:59918; EC=2.3.1.275; |
| DNA Binding | |
| EC Number | 2.3.1.275 |
| Enzyme Function | FUNCTION: Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as fatty acyl donor, but not acyl-CoA or acyl-ACP. {ECO:0000269|PubMed:17557823, ECO:0000269|PubMed:17645809, ECO:0000269|PubMed:19282621}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Lipid metabolism; phospholipid metabolism. |
| nucleotide Binding | |
| Features | Chain (1); Transmembrane (5) |
| Keywords | Cell membrane;Lipid biosynthesis;Lipid metabolism;Membrane;Phospholipid biosynthesis;Phospholipid metabolism;Reference proteome;Transferase;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 20,966 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:34075 |
| Cross Reference Brenda | 2.3.1.275; |