| IED ID | IndEnz0004000034 |
| Enzyme Type ID | xylanase000034 |
| Protein Name |
Ethylene-responsive transcription factor 4 Ethylene-responsive element-binding factor 3 EREBP-3 Ethylene-responsive element-binding factor 4 homolog NtERF3 |
| Gene Name | ERF4 ERF-3 ERF3 |
| Organism | Nicotiana tabacum (Common tobacco) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Nicotianoideae Nicotianeae Nicotiana Nicotiana tabacum (Common tobacco) |
| Enzyme Sequence | MAVKNKVSNGNLKGGNVKTDGVKEVHYRGVRKRPWGRYAAEIRDPGKKSRVWLGTFDTAEEAAKAYDTAAREFRGPKAKTNFPSPTENQSPSHSSTVESSSGENGVHAPPHAPLELDLTRRLGSVAADGGDNCRRSGEVGYPIFHQQPTVAVLPNGQPVLLFDSLWRAGVVNRPQPYHVTPMGFNGVNAGVGPTVSDSSSAVEENQYDGKRGIDLDLNLAPPMEF |
| Enzyme Length | 225 |
| Uniprot Accession Number | Q40477 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 26..83; /note=AP2/ERF; /evidence=ECO:0000255|PROSITE-ProRule:PRU00366 |
| EC Number | |
| Enzyme Function | FUNCTION: Acts as a transcriptional repressor. Binds to the GCC-box pathogenesis-related promoter element. Involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways mediated by ethylene, that seems to depend on a protein kinase/phosphatase cascade, and to be influenced by methyl-jasmonate. May regulate other AtERFs (By similarity). {ECO:0000250, ECO:0000269|PubMed:10652129, ECO:0000269|PubMed:10792818, ECO:0000269|PubMed:12654868, ECO:0000269|PubMed:7756828, ECO:0000269|Ref.2}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (1); DNA binding (1); Motif (1); Region (3) |
| Keywords | DNA-binding;Ethylene signaling pathway;Nucleus;Plant defense;Reference proteome;Repressor;Transcription;Transcription regulation;Ubl conjugation |
| Interact With | |
| Induction | INDUCTION: Strongly induced by ethephon (ethylene-releasing compound) in buds and to lower extent in leaves. Strongly induced by cycloheximide and mechanical stimuli. Wounding leads to a both local and systemical transient expression, independently of ethylene, and through a de-novo-protein-synthesis-independent regulation. Not influenced by methyl-jasmonate. Induction by purified xylanase from Trichoderma viride (TvX) and another elicitor from Phytophthora infestans (PiE), that appears to be mediated by a protein kinase cascade, and to be negatively regulated by protein phosphatases. {ECO:0000269|PubMed:10652129, ECO:0000269|PubMed:12090623, ECO:0000269|PubMed:7756828, ECO:0000269|Ref.2}. |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000255|PROSITE-ProRule:PRU00366, ECO:0000269|PubMed:10792818}. |
| Modified Residue | |
| Post Translational Modification | PTM: Probably negatively regulated by UBC2, that targets it to the ubiquitin proteasome pathway after ubiquitination and leads it to proteolysis. {ECO:0000305}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11487705; 23629833; 25996234; |
| Motif | MOTIF 215..221; /note=EAR-like (transcriptional repression); /evidence=ECO:0000255 |
| Gene Encoded By | |
| Mass | 24,262 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |