| IED ID | IndEnz0004000130 |
| Enzyme Type ID | xylanase000130 |
| Protein Name |
Endo-1,4-beta-xylanase Xyn10A EC 3.2.1.4 EC 3.2.1.8 Fragments |
| Gene Name | |
| Organism | Gloeophyllum trabeum (Brown rot fungus) (Agaricus trabeus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetes incertae sedis Gloeophyllales Gloeophyllaceae Gloeophyllum Gloeophyllum trabeum (Brown rot fungus) (Agaricus trabeus) |
| Enzyme Sequence | LYMGTATDNGATAMLNLVESLKYSWVPSTFSGQGAATPYDSNLVK |
| Enzyme Length | 45 |
| Uniprot Accession Number | P84195 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Endohydrolysis of (1->4)-beta-D-xylosidic linkages in xylans.; EC=3.2.1.8; Evidence={ECO:0000269|PubMed:15870328}; CATALYTIC ACTIVITY: Reaction=Endohydrolysis of (1->4)-beta-D-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.; EC=3.2.1.4; Evidence={ECO:0000269|PubMed:15870328}; |
| DNA Binding | |
| EC Number | 3.2.1.4; 3.2.1.8 |
| Enzyme Function | FUNCTION: Has xylanase, avicelase and cellobiohydrolase activity. {ECO:0000269|PubMed:15870328}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Glycan degradation; xylan degradation. |
| nucleotide Binding | |
| Features | Chain (1); Non-adjacent residues (2); Non-terminal residue (2) |
| Keywords | Carbohydrate metabolism;Cellulose degradation;Direct protein sequencing;Glycosidase;Hydrolase;Polysaccharide degradation;Secreted;Xylan degradation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, extracellular space {ECO:0000269|PubMed:15870328}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 4,771 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |