| IED ID | IndEnz0004000155 |
| Enzyme Type ID | xylanase000155 |
| Protein Name |
Universal stress protein PHOS32 Phosphorylated protein of 32 kDa AtPHOS32 |
| Gene Name | PHOS32 At5g54430 F24B18.5 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MNPADSDHPQLPNIKIHHPPSPRHSHHHHSSSTPSSAATPTPTAGARRKIGVAVDLSEESSFAVRWAVDHYIRPGDAVVLLHVSPTSVLFGADWGPLPLKTQIEDPNAQPQPSQEDFDAFTSTKVADLAKPLKELGFPYKIHIVKDHDMRERLCLEIERLGLSAVIMGSRGFGAEKKRGSDGKLGSVSDYCVHHCVCPVVVVRYPDDRDGPVPIVTVKSGGDDDGDVVAASASAHHEHIKDE |
| Enzyme Length | 242 |
| Uniprot Accession Number | Q8VYN9 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | BINDING 19; /note=ATP; via carbonyl oxygen; /evidence=ECO:0000250|UniProtKB:Q57997; BINDING 83; /note=ATP; via amide nitrogen and carbonyl oxygen; /evidence=ECO:0000250|UniProtKB:Q57997 |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | NP_BIND 168..178; /note=ATP; /evidence=ECO:0000250|UniProtKB:Q57997; NP_BIND 186..188; /note=ATP; /evidence=ECO:0000250|UniProtKB:Q57997 |
| Features | Binding site (2); Chain (1); Erroneous gene model prediction (1); Modified residue (2); Mutagenesis (1); Nucleotide binding (2); Region (1); Transit peptide (1) |
| Keywords | ATP-binding;Chloroplast;Nucleotide-binding;Phosphoprotein;Plastid;Reference proteome;Transit peptide |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Plastid, chloroplast {ECO:0000255}. |
| Modified Residue | MOD_RES 21; /note="Phosphoserine; by MAPK3 and MAPK6"; /evidence="ECO:0000269|PubMed:18285339, ECO:0000269|PubMed:18785823, ECO:0007744|PubMed:18433157, ECO:0007744|PubMed:19376835"; MOD_RES 219; /note="Phosphoserine"; /evidence="ECO:0007744|PubMed:18433157" |
| Post Translational Modification | PTM: Phosphorylated by MAPK3 and MAPK6 after pathogenic elicitation (e.g. bacterial flg22, Phytophthora infestans zoospores and xylanase). {ECO:0000269|PubMed:18285339, ECO:0000269|PubMed:18785823}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 14576160; 17317660; 21166475; 28627464; 30833711; |
| Motif | |
| Gene Encoded By | |
| Mass | 26,202 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |