| IED ID |
IndEnz0004000174 |
| Enzyme Type ID |
xylanase000174 |
| Protein Name |
Cell division suppressor protein YneA
|
| Gene Name |
yneA BSU17860 |
| Organism |
Bacillus subtilis (strain 168) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Bacillales
Bacillaceae
Bacillus
Bacillus subtilis group
Bacillus subtilis
Bacillus subtilis subsp. subtilis
Bacillus subtilis (strain 168)
|
| Enzyme Sequence |
MIMSKESIIFVGLFTVILSAVILMLSYTSSGQELNQYVKIEVQQGDTLWSIADQVADTKKINKNDFIEWVADKNQLQTSDIQPGDELVIPLKKKHQDAYELATVR |
| Enzyme Length |
105 |
| Uniprot Accession Number |
Q45056 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Inhibits cell division during the SOS response. Affects a later stage of the cell division protein assembly, after the assembly of the Z ring, by probably suppressing recruitment of FtsL and/or DivIC to the division machinery (By similarity). {ECO:0000250, ECO:0000269|PubMed:12581363, ECO:0000269|PubMed:16549676}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Domain (1) |
| Keywords |
Cell cycle;Cell division;Cytoplasm;DNA damage;DNA repair;Reference proteome;SOS response;Septation |
| Interact With |
|
| Induction |
INDUCTION: Repressed by LexA. {ECO:0000269|PubMed:12581363}. |
| Subcellular Location |
SUBCELLULAR LOCATION: Cytoplasm {ECO:0000305}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
11,888 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|