| IED ID | IndEnz0004000187 |
| Enzyme Type ID | xylanase000187 |
| Protein Name |
Endo-1,4-beta-xylanase C Xylanase B EC 3.2.1.8 1,4-beta-D-xylan xylanohydrolase C |
| Gene Name | XYLC FGRRES_11487 FGSG_11487 |
| Organism | Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) (Wheat head blight fungus) (Fusarium graminearum) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta sordariomyceta Sordariomycetes Hypocreomycetidae Hypocreales Nectriaceae Fusarium Fusarium sambucinum species complex Gibberella zeae (Wheat head blight fungus) (Fusarium graminearum) Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) (Wheat head blight fungus) (Fusarium graminearum) |
| Enzyme Sequence | MKFSSLLFTASLVAAMPASIEPRQAQESINKLIKAKGKLYYGTITDPNLLQSQQNNAVIKADFGQVTPENSMKWDATEPQQGKFNFGGGDQVVNFAAQNGLKVRGHALVWHSQLPQWVHNIKDKTQMKNAIENHIKNVAGHFKGKVYAWDVLNEIFDWDGSLRKDSPFTQVLGEEFVGIAFRAARAADPNAKLYINDYSIDDPNAAKLKAGMVAHVKKWVSQGIPIDGIGSQTHLDPGAANGVQAALQQMASTGVKEVAITELDIRSAPAADYATVTKACLNVPKCVGITVWGVSDKDSWRKEKDSLLFNAQYQAKPAYTAVVNALR |
| Enzyme Length | 327 |
| Uniprot Accession Number | I1S3T9 |
| Absorption | |
| Active Site | ACT_SITE 154; /note=Proton donor; /evidence=ECO:0000250; ACT_SITE 262; /note=Nucleophile; /evidence=ECO:0000250 |
| Activity Regulation | ACTIVITY REGULATION: Weakly inhibited by the wheat xylanase inhibiting protein I (XIP-I). {ECO:0000269|Ref.6}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Endohydrolysis of (1->4)-beta-D-xylosidic linkages in xylans.; EC=3.2.1.8; Evidence={ECO:0000269|Ref.6}; |
| DNA Binding | |
| EC Number | 3.2.1.8 |
| Enzyme Function | FUNCTION: Endo-1,4-beta-xylanase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose. Plays an important role in causing fusarium head blight (FHB) on cereal crops. {ECO:0000269|Ref.6}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 40 degrees Celsius. {ECO:0000269|Ref.6}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 5.0-7.0. {ECO:0000269|Ref.6}; |
| Pathway | PATHWAY: Glycan degradation; xylan degradation. |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Disulfide bond (1); Domain (1); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Disulfide bond;Glycosidase;Hydrolase;Polysaccharide degradation;Reference proteome;Secreted;Signal;Virulence;Xylan degradation |
| Interact With | |
| Induction | INDUCTION: Expression is under the control of transcription factor XYR1 and highly induced by xylan, carboxymethylcellulose (CMC), and hop cell wall. {ECO:0000269|PubMed:16707104, ECO:0000269|PubMed:17924109, ECO:0000269|PubMed:23337356}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..15; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 35,739 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=3.6 mg/ml for wheat flour arabinoxylan {ECO:0000269|Ref.6}; KM=3.5 mg/ml for soluble oat spelt xylan {ECO:0000269|Ref.6}; KM=6.3 mg/ml for soluble birchwood xylan {ECO:0000269|Ref.6}; |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |