| IED ID | IndEnz0004000207 |
| Enzyme Type ID | xylanase000207 |
| Protein Name |
Endo-1,4-beta-xylanase Xyn11E EC 3.2.1.8 |
| Gene Name | xyn11E DFQ00_11065 |
| Organism | Paenibacillus barcinonensis |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Paenibacillaceae Paenibacillus Paenibacillus barcinonensis |
| Enzyme Sequence | MFKFGKKLMTVVLAASMSFGVFAATTGATDYWQNWTDGGGTVNAVNGSGGNYSVNWQNTGNFVVGKGWTYGTPNRVVNYNAGVFSPSGNGYLTFYGWTRNALIEYYVVDNWGTYRPTGTYKGTVNSDGGTYDIYTTMRYNQPSIDGYSTFPQYWSVRQSKRPIGVNSQITFQNHVNAWASKGMNLGSSWSYQVLATEGYQSSGSSNVTVW |
| Enzyme Length | 210 |
| Uniprot Accession Number | V9TXH2 |
| Absorption | |
| Active Site | ACT_SITE 104; /note="Nucleophile"; /evidence="ECO:0000255|PROSITE-ProRule:PRU01097, ECO:0000255|PROSITE-ProRule:PRU10062"; ACT_SITE 197; /note="Proton donor"; /evidence="ECO:0000255|PROSITE-ProRule:PRU01097, ECO:0000255|PROSITE-ProRule:PRU10062" |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Endohydrolysis of (1->4)-beta-D-xylosidic linkages in xylans.; EC=3.2.1.8; Evidence={ECO:0000269|PubMed:24549767}; |
| DNA Binding | |
| EC Number | 3.2.1.8 |
| Enzyme Function | FUNCTION: Involved in depolymerization of xylan, a major component of the lignocellulosic substrates. Acts as an endo-xylanase that efficiently hydrolyzes the beta-1,4 glycosidic linkages between the xylopyranosyl residues in the main chain of the polymer, leading to the degradation of xylan into short oligosaccharides. Shows high activity toward branched xylans from both softwoods (arabinoxylans) and hardwoods (glucuronoxylans), showing the highest activity on beechwood xylan. Also hydrolyzes long xylooligosaccharides (with a degree of polymerization of greater than or equal to 5), while oligomers shorter than xylotetraose are not degraded. Is not active on carboxymethyl cellulose (CMC), Avicel, starch, polygalacturonic acid, laminarin, pectin, beta-D-barley glucan, or lichenan. {ECO:0000269|PubMed:24549767}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 50 degrees Celsius. Retains about 80% of the activity after incubation for 2 hours at 50 degrees Celsius, but is rapidly inactivated at higher temperatures. {ECO:0000269|PubMed:24549767}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 6.5. {ECO:0000269|PubMed:24549767}; |
| Pathway | PATHWAY: Glycan degradation; xylan degradation. {ECO:0000269|PubMed:24549767}. |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Domain (1); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Glycosidase;Hydrolase;Polysaccharide degradation;Secreted;Signal;Xylan degradation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305|PubMed:24549767}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 23,145 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=12.98 mg/ml for beechwood xylan {ECO:0000269|PubMed:24549767}; Vmax=3023 umol/min/mg enzyme for the hydrolysis of beechwood xylan {ECO:0000269|PubMed:24549767}; |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |