| IED ID |
IndEnz0004000240 |
| Enzyme Type ID |
xylanase000240 |
| Protein Name |
Membrane protein YneK
|
| Gene Name |
yneK yoxJ BSU17960 |
| Organism |
Bacillus subtilis (strain 168) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Bacillales
Bacillaceae
Bacillus
Bacillus subtilis group
Bacillus subtilis
Bacillus subtilis subsp. subtilis
Bacillus subtilis (strain 168)
|
| Enzyme Sequence |
MLEGWFLWFILFWVIMMVVLLSIGGFFMFRKFLKRLPKEDGRSELDWQDYYIENSRHLWNDENKQFLDELTAPVPELFRDAAKAKIAGKIGELALKEKVAKIDQQLMIKGYILATPKRDHTFLKRHLRDKKIDLEPYQTLLK |
| Enzyme Length |
142 |
| Uniprot Accession Number |
P45711 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
|
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Transmembrane (1) |
| Keywords |
Cell membrane;Membrane;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:23060960}; Single-pass membrane protein {ECO:0000255}. Note=Forms foci, some at cell poles, some at midcell possibly at septation sites; in the absence of minJ foci are lost. {ECO:0000269|PubMed:23060960}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
16,989 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|