| IED ID | IndEnz0004000254 |
| Enzyme Type ID | xylanase000254 |
| Protein Name |
Reducing end xylose-releasing exo-oligoxylanase RexA EC 3.2.1.156 |
| Gene Name | xylA BAD_0300 |
| Organism | Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Bifidobacteriales Bifidobacteriaceae Bifidobacterium Bifidobacterium adolescentis Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) |
| Enzyme Sequence | MTNATDTNKTLGESMFAQCGYAQDAIDKRVSQVWHEIFEGPNKFYWENDEGLAYVMDTGNNDVRTEGMSYAMMIALQYDRKDVFDKLWGWVMRHMYMKDGHHAHYFAWSVAPDGTPNSNGPAPDGEEYFAMDLFLASRRWGDGEDIYEYSAWGREILRYCVHKGERYDGEPMWNPDNKLIKFIPETEWSDPSYHLPHFYEVFAEEADEEDRPFWHEAAAASRRYLQAACDERTGMNAEYADYDGKPHVDESNHWHFYSDAYRTAANIGLDAAWNGPQEVLCDRVAALQRFFLTHDRTSVYAIDGTAVDEVVLHPVGFLAATAQGALAAVHSAQPDAEHNAREWVRMLWNTPMRTGTRRYYDNFLYAFAMLALSGKYRYE |
| Enzyme Length | 379 |
| Uniprot Accession Number | A1A048 |
| Absorption | |
| Active Site | ACT_SITE 66; /note=Proton donor; /evidence=ECO:0000250|UniProtKB:A0A0S2UQQ5; ACT_SITE 259; /note=Proton acceptor; /evidence=ECO:0000250|UniProtKB:A0A0S2UQQ5 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of (1->4)-beta-D-xylose residues from the reducing end of oligosaccharides.; EC=3.2.1.156; Evidence={ECO:0000269|PubMed:17586675}; |
| DNA Binding | |
| EC Number | 3.2.1.156 |
| Enzyme Function | FUNCTION: Hydrolyzes xylooligosaccharides with a degree of polymerization of greater than or equal to 3, releasing xylose from the reducing end. Has low activity on birchwood xylan, oat spelt xylan and arabinoxylan. {ECO:0000269|PubMed:17586675}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 40 degrees Celsius. Stable up to 40 degrees Celsius. {ECO:0000269|PubMed:17586675}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 6.0. Stable between pH 4.0 and 10.0 for 120 minutes. {ECO:0000269|PubMed:17586675}; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1) |
| Keywords | Carbohydrate metabolism;Glycosidase;Hydrolase;Polysaccharide degradation;Reference proteome;Xylan degradation |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 43,785 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.2.1.156; |