| IED ID |
IndEnz0004000258 |
| Enzyme Type ID |
xylanase000258 |
| Protein Name |
Chaperone protein LppX
|
| Gene Name |
lppX DFQ00_11066 |
| Organism |
Paenibacillus barcinonensis |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Bacillales
Paenibacillaceae
Paenibacillus
Paenibacillus barcinonensis
|
| Enzyme Sequence |
MRKWLIFLLIAAVAGLSACSTSGNTTVSDDLVLVEGGAFKTSKSSYSDKNVTLSDFYIGKYEVTQKQWMDVMGDNPSGFKGEERPVERVTWYDAIEYCNARSIKENLKPYYTIDKETTDPDNKNENDNIKWTVTINEGANGYRLPTGAEWEYAASGGQKSQNFTYSGSNNPDEVAWYWMNAGEKPLTGDWNWPAIENNRNQTKPVGQQKANELGIYDMSGNVREWCWEWHSHPETPENTWRISKGGGWVSSVNTAEISYPGKFDANGLGPDQGLRVVRSK |
| Enzyme Length |
280 |
| Uniprot Accession Number |
V9TSX0 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Is required for the expression of the adjacently encoded xylanase Xyn11E in an active form. LppX seems to act as a specific chaperone necessary for the correct folding of the xylanase during secretion across the cytoplasmic membrane. {ECO:0000269|PubMed:24549767}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Lipidation (2); Signal peptide (1) |
| Keywords |
Cell membrane;Chaperone;Lipoprotein;Membrane;Palmitate;Signal |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Cell membrane {ECO:0000255|PROSITE-ProRule:PRU00303}; Lipid-anchor {ECO:0000255|PROSITE-ProRule:PRU00303}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
SIGNAL 1..18; /evidence=ECO:0000255|PROSITE-ProRule:PRU00303 |
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
31,488 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|