Detail Information for IndEnz0004000262
IED ID IndEnz0004000262
Enzyme Type ID xylanase000262
Protein Name Xylan alpha-
1-
2
-glucuronosidase
EC 3.2.1.131
Alpha-glucuronidase
Gene Name aguA
Organism Geobacillus stearothermophilus (Bacillus stearothermophilus)
Taxonomic Lineage cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Geobacillus Geobacillus stearothermophilus (Bacillus stearothermophilus)
Enzyme Sequence MTAGYEPCWLRYERKDQYSRLRFEEIVAKRTSPIFQAVVEELQKGLRSMMEIEPQVVQEVNETANSIWLGTLEDEEFERPLEGTLVHPEGYVIRSDVDDGPFRIYIIGKTDAGVLYGVFHFLRLLQMGENIAQLSIIEQPKNRLRMINHWDNMDGSIERGYAGRSIFFVDDQFVKQNQRIKDYARLLASVGINAISINNVNVHKTETKLITDHFLPDVAEVADIFRTYGIKTFLSINYASPIEIGGLPTADPLDPEVRRWWKETAKRIYQYIPDFGGFVVKADSEFRPGPFTYGRDHAEGANMLAEALAPFGGLVIWRCFVYNCQQDWRDRTTDRAKAAYDHFKPLDGQFRENVILQIKNGPMDFQVREPVSPLFGAMPKTNQMMEVQITQEYTGQQKHLCFLIPQWKEVLDFDTYAKGKGSEVKKVIDGSLFDYRYSGIAGVSNIGSDPNWTGHTLAQANLYGFGRLAWNPDLSAEEIANEWVVQTFGDDSQVVETISWMLLSSWRIYENYTSPLGVGWMVNPGHHYGPNVDGYEYSHWGTYHYADRDGIGVDRTVATGTGYTAQYFPENAAMYESLDTCPDELLLFFHHVPYTHRLHSGETVIQHIYNTHFEGVEQAKQLRKRWEQLKGKIDEKRYHDVLERLTIQVEHAKEWRDVINTYFYRKSGIDDQYGRKIYR
Enzyme Length 679
Uniprot Accession Number Q09LY5
Absorption
Active Site ACT_SITE 285; /note=Proton donor; /evidence=ECO:0000269|PubMed:14573597; ACT_SITE 364; /note=Proton acceptor; /evidence=ECO:0000269|PubMed:14573597; ACT_SITE 392; /note=Proton acceptor; /evidence=ECO:0000269|PubMed:14573597
Activity Regulation ACTIVITY REGULATION: The metal cations Ni(2+), K(+) and Zn(2+) show some inhibition of the activity, and Ag(+), Hg(2+) and Cu(2+) shows very significant inhibition even at relatively low ion concentrations. {ECO:0000269|PubMed:11358519}.
Binding Site BINDING 201; /note=beta-D-glucuronic acid; /evidence=ECO:0000250; BINDING 281; /note=Substrate; BINDING 318; /note=Substrate; BINDING 335; /note=Substrate; BINDING 359; /note=Substrate; BINDING 386; /note=Substrate; /evidence=ECO:0000250; BINDING 510; /note=Substrate; /evidence=ECO:0000250; BINDING 540; /note=Substrate; /evidence=ECO:0000250
Calcium Binding
catalytic Activity CATALYTIC ACTIVITY: Reaction=Hydrolysis of (1->2)-alpha-D-(4-O-methyl)glucuronosyl links in the main chain of hardwood xylans.; EC=3.2.1.131;
DNA Binding
EC Number 3.2.1.131
Enzyme Function FUNCTION: Alpha-glucuronidase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose. It catalyzes the cleavage of alpha-1,2-glycosidic bond of the 4-O-methyl-D-glucuronic acid side chain of xylan and releases 4-O-methylglucuronic acid from xylan. {ECO:0000269|PubMed:11358519}.
Temperature Dependency BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 65 degrees Celsius. The enzyme is stable up to 70 degrees Celsius and lost 70% of its activity at 75 degrees Celsius. {ECO:0000269|PubMed:11358519};
PH Dependency BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 5.5-6. It retains about 40% of its activity at pH 4.5 and 7.5. {ECO:0000269|PubMed:11358519};
Pathway
nucleotide Binding
Features Active site (3); Beta strand (23); Binding site (8); Chain (1); Helix (27); Mutagenesis (6); Region (1); Site (2); Turn (9)
Keywords 3D-structure;Carbohydrate metabolism;Glycosidase;Hydrolase;Polysaccharide degradation;Xylan degradation
Interact With
Induction
Subcellular Location
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D X-ray crystallography (4)
Cross Reference PDB 1K9E; 1K9F; 1MQP; 1MQR;
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 78,484
Kinetics BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=0.2 mM for aldotetraouronic acid (at 55 degrees Celsius) {ECO:0000269|PubMed:11358519}; Vmax=42 umol/min/ug enzyme with aldotetraouronic acid as substrate (at 55 degrees Celsius) {ECO:0000269|PubMed:11358519};
Metal Binding
Rhea ID
Cross Reference Brenda 3.2.1.139;