| IED ID |
IndEnz0004000263 |
| Enzyme Type ID |
xylanase000263 |
| Protein Name |
Spore coat protein M
|
| Gene Name |
cotM yneL BSU17970 |
| Organism |
Bacillus subtilis (strain 168) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Bacillales
Bacillaceae
Bacillus
Bacillus subtilis group
Bacillus subtilis
Bacillus subtilis subsp. subtilis
Bacillus subtilis (strain 168)
|
| Enzyme Sequence |
MWRNASMNHSKRNDANDFDSMDEWLRQFFEDPFAWYDETLPIDLYETSQQYIIEADLTFLQPTQVTVTLSGCEFILTVKSSGQTFEKQMMLPFYFNDKNIQVECENQILTVAVNKETEDGSSFSLQFPLS |
| Enzyme Length |
130 |
| Uniprot Accession Number |
Q45058 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Involved in spore outer coat assembly. May be part of a cross-linked insoluble skeleton that surrounds the spore, serves as a matrix for the assembly of additional outer coat material, and confers structural stability to the final structure. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Erroneous initiation (1) |
| Keywords |
Reference proteome;Sporulation |
| Interact With |
|
| Induction |
INDUCTION: Induced during development under sigma-K control and negatively regulated by GerE. |
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
15,222 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|