| IED ID |
IndEnz0004000266 |
| Enzyme Type ID |
xylanase000266 |
| Protein Name |
Cytochrome c-type biogenesis protein CcdA
|
| Gene Name |
ccdA BSU17930 |
| Organism |
Bacillus subtilis (strain 168) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Bacillales
Bacillaceae
Bacillus
Bacillus subtilis group
Bacillus subtilis
Bacillus subtilis subsp. subtilis
Bacillus subtilis (strain 168)
|
| Enzyme Sequence |
MGDVNYFLTFGAGFLSFISPCCLPLYPAFLSYITGVSMDDVKTEKLLLQKRSLFHTLCFLLGFSVIFIALGYGTSFIGSLFRDYHDAIRQIGALLIILFGFITLGVFRPEAMMKERRIHFKHKPSGFLGSVLIGMAFAAGWTPCTGPILAAVITLAGTNPGSAVPYMMLYVLGFAVPFLLLSFFITKLKWIRKNQLFIMKAGGVLMIVIGVLLFFNWMSLIIILLSDLFGGFTGF |
| Enzyme Length |
235 |
| Uniprot Accession Number |
P45706 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Required for cytochrome c synthesis and stage V of sporulation. Might transfer reducing equivalents across the cytoplasmic membrane, promoting efficient disulfide bond isomerization of proteins localized on the outer surface of the membrane or in the spore coat. {ECO:0000269|PubMed:10781554}.; FUNCTION: Cytochrome c oxidase activity is partially restored by mutations in bdbC or bdbD that are defective in the synthesis of disulfide bond containing proteins. The same mutations abrogate the need for CcdA in sporulation. {ECO:0000269|PubMed:10781554}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Transmembrane (6) |
| Keywords |
Cell membrane;Cytochrome c-type biogenesis;Membrane;Reference proteome;Sporulation;Transmembrane;Transmembrane helix |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:10781554}; Multi-pass membrane protein {ECO:0000269|PubMed:10781554}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
26,007 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|