| IED ID | IndEnz0004000272 |
| Enzyme Type ID | xylanase000272 |
| Protein Name |
Gamma conglutin 2 Conglutin gamma 48 allergen Lup a gamma-conglutin Cleaved into: Gamma conglutin 2 beta subunit Gamma conglutin 2 small subunit ; Gamma conglutin 2 alpha subunit Gamma conglutin 2 large subunit |
| Gene Name | |
| Organism | Lupinus albus (White lupine) (Lupinus termis) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade genistoids sensu lato core genistoids Genisteae Lupinus Lupinus albus (White lupine) (Lupinus termis) |
| Enzyme Sequence | MAKNMAQIFPFIAVFLSCSFIFVLSSSQNSQSLYHNPQSTSSSSSKPSLLVLPIQQDASTGLHWANIHKRTPLMQVPVLLDLNGKHLWVTCSYHYSSSTYQAPFCHSTQCSRANSHHCFTCTDSATSRPGCHNNTCALMSSNPVTQEAGFGELAQDVLAIHSTHGSKLGPMVRVLQYLFSCAPSFLAQKGLPNNVQGPLGLGHAPISLQNQLFSHFGLKRQFAMCLSRYPTSNGAILFGDIYDLDNNYIHNSIDVLIDMVYTPLRISQQGEYFMQVNAIRVNKHMVVPTKNPSMLSSYHGDSRIGGAMITTTNPYTILHHSIFEVFTQVFANNMPKEAQVESVGPFGLCYDSRKLSGGIPSVEFVMDSHDDVWRISDENLMVQAQNGVSCLGFVDGGMHTRTEIVLGTHQLEENMVVFDLERSRVEFNSNSLKSHGKTCANIFDLNNA |
| Enzyme Length | 448 |
| Uniprot Accession Number | Q9FEX1 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Sulfur-rich seed storage protein that remains undegraded at germination. {ECO:0000303|PubMed:11406286}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (3); Disulfide bond (7); Domain (1); Glycosylation (1); Signal peptide (1); Site (1) |
| Keywords | Allergen;Direct protein sequencing;Disulfide bond;Glycoprotein;Secreted;Signal |
| Interact With | |
| Induction | INDUCTION: Secreted in high amounts upon heat treatment of mature seeds. {ECO:0000303|PubMed:11406286}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, extracellular space {ECO:0000303|PubMed:11406286}. Note=Present in the extracellular spaces of germinating cotyledons and in the young roots. {ECO:0000303|PubMed:11406286}. |
| Modified Residue | |
| Post Translational Modification | PTM: Glycosylated on alpha chain. {ECO:0000250|UniProtKB:Q42369}. |
| Signal Peptide | SIGNAL 1..33; /evidence=ECO:0000250|UniProtKB:Q9FSH9 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 49,513 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |