| IED ID | IndEnz0004000273 |
| Enzyme Type ID | xylanase000273 |
| Protein Name |
Ethylene-responsive transcription factor 5 Ethylene-responsive element-binding factor 4 EREBP-4 Ethylene-responsive element-binding factor 5 homolog NtERF4 |
| Gene Name | ERF5 ERF-4 ERF4 |
| Organism | Nicotiana tabacum (Common tobacco) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Nicotianoideae Nicotianeae Nicotiana Nicotiana tabacum (Common tobacco) |
| Enzyme Sequence | MASPQENCTTLDLIRQHLLDDNVFMEHYCPQPILYSQSSSSSESLNSIASELNNETFSFEPTLKYADTAQSSNLDISSFFNNSKTEFDSFEFETKPNVSAARISSNSPKQTSFKERKPSLNIAIPMKQQEVVQKVEVVPTEKKHYRGVRQRPWGKFAAEIRDPNRKGTRVWLGTFDTAIEAAKAYDRAAFKLRGSKAIVNFPLEVANFKQQDNEILQPANSGRKRMRETENEEIVIKKEVKREERVPAAAAPLTPSSWSAIWEGEDGKGIFEVPPLSPLSPHMAYSQLVMI |
| Enzyme Length | 291 |
| Uniprot Accession Number | Q40478 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 144..202; /note=AP2/ERF; /evidence=ECO:0000255|PROSITE-ProRule:PRU00366 |
| EC Number | |
| Enzyme Function | FUNCTION: Acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. Involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways mediated by ethylene, that seems to depend on a protein kinase/phosphatase cascade, and to be influenced by methyl-jasmonate. {ECO:0000269|PubMed:10652129, ECO:0000269|PubMed:10792818, ECO:0000269|PubMed:7756828, ECO:0000269|Ref.2}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); DNA binding (1) |
| Keywords | Activator;DNA-binding;Ethylene signaling pathway;Nucleus;Plant defense;Reference proteome;Transcription;Transcription regulation |
| Interact With | |
| Induction | INDUCTION: Strongly induced by ethephon (ethylene-releasing compound) in buds and in leaves. Also strongly induced by cycloheximide, mechanical stimuli. Wounding leads to a both local and systemic expression, independently of ethylene, and through a de-novo-protein-synthesis-independent regulation. Wound induction is reduced by methyl-jasmonate. Induction by purified xylanase from Trichoderma viride (TvX) and another elicitor from Phytophthora infestans (PiE), that appears to be mediated by a protein kinase cascade, and to be negatively regulated by protein phosphatases. {ECO:0000269|PubMed:10652129, ECO:0000269|PubMed:12090623, ECO:0000269|PubMed:7756828, ECO:0000269|Ref.2}. |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000255|PROSITE-ProRule:PRU00366, ECO:0000269|PubMed:10792818}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 32,878 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |