| IED ID | IndEnz0005000029 |
| Enzyme Type ID | lipase000029 |
| Protein Name |
Spore germination lipase LipC EC 3.-.-.- |
| Gene Name | lipC ycsK BSU04110 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MVLRYTALGDSLTTGRGSGLFSPGFVQRFGDMMEADLKTRTAINIFARSGLNTEEILGLLSYPYVQKCIRDADMITITGCGNDLIDSVLAYQTSKDETIFSRVSAHCHENFEKMIAKVAEIKGENPSPYAIRVFNLYNPFPEIDIAGKWITSFNSHLETLASAPHVKIADAYSIFKGKEQEYLSFDGVHPNSKGYQAMAEAVHKLGYKELSVS |
| Enzyme Length | 213 |
| Uniprot Accession Number | P42969 |
| Absorption | |
| Active Site | ACT_SITE 11; /note=Nucleophile; /evidence=ECO:0000250; ACT_SITE 186; /evidence=ECO:0000250; ACT_SITE 189; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | BINDING 50; /note=Substrate; via amide nitrogen; /evidence=ECO:0000250; BINDING 82; /note=Substrate; /evidence=ECO:0000250 |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.-.-.- |
| Enzyme Function | FUNCTION: Lipase involved in spore germination. {ECO:0000269|PubMed:17220230}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Binding site (2); Chain (1) |
| Keywords | Hydrolase;Reference proteome;Sporulation |
| Interact With | |
| Induction | INDUCTION: Transcribed under the control of SigK and positively regulated by GerE. |
| Subcellular Location | SUBCELLULAR LOCATION: Spore coat {ECO:0000269|PubMed:17220230}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 23,606 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |