| IED ID | IndEnz0005000078 |
| Enzyme Type ID | lipase000078 |
| Protein Name |
Ras-related protein Rab-7a EC 3.6.5.2 |
| Gene Name | rab7A rab7 DDB_G0269236 |
| Organism | Dictyostelium discoideum (Slime mold) |
| Taxonomic Lineage | cellular organisms Eukaryota Amoebozoa Evosea Eumycetozoa Dictyostelia (dictyostelid cellular slime molds) Dictyosteliales Dictyosteliaceae Dictyostelium Dictyostelium discoideum (Slime mold) |
| Enzyme Sequence | MATKKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKELMVDDRVVTMQIWDTAGQERFQSLGVAFYRGADCCVLCYDVNVAKTFENLDSWRDEFLIQAGPRDPDNFPFVVLGNKIDLENQRVVSQKRAASWCQSKGNIPYFETSAKEAINVEQAFQTIARNAIKLEDGLVFPIPTNIQVIPEPQPAKSGCC |
| Enzyme Length | 203 |
| Uniprot Accession Number | P36411 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=GTP + H2O = GDP + H(+) + phosphate; Xref=Rhea:RHEA:19669, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:37565, ChEBI:CHEBI:43474, ChEBI:CHEBI:58189; EC=3.6.5.2; Evidence={ECO:0000250|UniProtKB:P51149};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:19670; Evidence={ECO:0000250|UniProtKB:P51149}; |
| DNA Binding | |
| EC Number | 3.6.5.2 |
| Enzyme Function | FUNCTION: Small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins playing a key role in the regulation of endo-lysosomal trafficking. Governs early-to-late endosomal maturation, microtubule minus-end as well as plus-end directed endosomal migration and positioning, and endosome-lysosome transport through different protein-protein interaction cascades (By similarity). Involved in lipophagy, a cytosolic lipase-independent autophagic pathway (By similarity). {ECO:0000250|UniProtKB:P51149, ECO:0000250|UniProtKB:P51150}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | NP_BIND 15..22; /note=GTP; /evidence=ECO:0000250; NP_BIND 34..40; /note=GTP; /evidence=ECO:0000250; NP_BIND 63..67; /note=GTP; /evidence=ECO:0000250; NP_BIND 125..128; /note=GTP; /evidence=ECO:0000250; NP_BIND 157..158; /note=GTP; /evidence=ECO:0000250 |
| Features | Chain (1); Lipidation (2); Motif (1); Nucleotide binding (5) |
| Keywords | Autophagy;Cytoplasmic vesicle;Endosome;GTP-binding;Hydrolase;Lipid degradation;Lipid droplet;Lipid metabolism;Lipoprotein;Lysosome;Membrane;Nucleotide-binding;Prenylation;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Late endosome membrane {ECO:0000250|UniProtKB:P51149}; Peripheral membrane protein {ECO:0000305}; Cytoplasmic side {ECO:0000305}. Lysosome membrane {ECO:0000250|UniProtKB:P51149}; Peripheral membrane protein {ECO:0000305}; Cytoplasmic side {ECO:0000305}. Cytoplasmic vesicle, autophagosome membrane {ECO:0000250|UniProtKB:P51149}; Peripheral membrane protein {ECO:0000305}; Cytoplasmic side {ECO:0000305}. Lipid droplet {ECO:0000250|UniProtKB:P51150}. Cytoplasmic vesicle {ECO:0000250|UniProtKB:P51150}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10025509; 11854420; 14504294; 16445684; 17488289; 18636095; 18980612; 19081545; 21056680; 21109012; 22120990; 24349132; 9422733; |
| Motif | MOTIF 37..45; /note=Effector region; /evidence=ECO:0000250 |
| Gene Encoded By | |
| Mass | 22,695 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:19669; RHEA:19670 |
| Cross Reference Brenda |