| IED ID | IndEnz0005000117 |
| Enzyme Type ID | lipase000117 |
| Protein Name |
Transcriptional regulator SarA Staphylococcal accessory regulator A |
| Gene Name | sarA NWMN_0588 |
| Organism | Staphylococcus aureus (strain Newman) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus Staphylococcus aureus (strain Newman) |
| Enzyme Sequence | MAITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISENKEKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKIESLLSRVNKRITEANNEIEL |
| Enzyme Length | 124 |
| Uniprot Accession Number | A6QES8 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Global regulator with both positive and negative effects that controls expression of several virulence factors and biofilm formation process in a cell density-dependent manner. In a strain-dependent manner plays a role in multidrug resistance mechanism. Is required for transcription of primary transcripts RNAII and RNAIII generated by agr (virulence accessory gene regulator) locus. Acts as a transcriptional activator of the genes encoding, among others, for fibronectin binding proteins (fnbA and fnbB), hemolysins (hla, hld, hlgB and hlgC), serine proteases (splA, splB, splD and splF) and of the bap gene, which is essential for biofilm development in some strains. Negatively regulates the expression of the genes for protein A (spa), lipase (lip), thermonuclease (nuc), immunodominant staphylococcal antigen B (isaB), staphylococcal serine and cysteine proteases (sspA and sspB), staphostatin B (sspC), metalloprotease aureolysin (aur) and collagen adhesin (cna). Probably activates the development of biofilm by both enhancing the ica operon transcription and suppressing the transcription of either a protein involved in the turnover of PIA/PNAG or a repressor of its synthesis, whose expression would be sigma-B-dependent. {ECO:0000269|PubMed:15321676, ECO:0000269|PubMed:16077127}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Initiator methionine (1); Metal binding (3) |
| Keywords | Activator;Cytoplasm;DNA-binding;Metal-binding;Repressor;Transcription;Transcription regulation;Virulence |
| Interact With | |
| Induction | INDUCTION: Expressed at the exponential growth phase and maximally induced during the transition from late exponential phase to stationary phase. Repressed by SarR and activated by two-component regulatory system ArlS/ArlR. Activated by SigB in strains harboring an intact sigB operon (rsbU, rsbV, rsbW, and sigB). Transcription is also attenuated by MsrR. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 14,718 |
| Kinetics | |
| Metal Binding | METAL 7; /note=Divalent metal cation; /evidence=ECO:0000250; METAL 8; /note=Divalent metal cation; /evidence=ECO:0000250; METAL 11; /note=Divalent metal cation; /evidence=ECO:0000250 |
| Rhea ID | |
| Cross Reference Brenda |