| IED ID |
IndEnz0005000123 |
| Enzyme Type ID |
lipase000123 |
| Protein Name |
Linearmycin resistance permease protein LnrN
|
| Gene Name |
lnrN bifN yfiN BSU08330 |
| Organism |
Bacillus subtilis (strain 168) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Bacillales
Bacillaceae
Bacillus
Bacillus subtilis group
Bacillus subtilis
Bacillus subtilis subsp. subtilis
Bacillus subtilis (strain 168)
|
| Enzyme Sequence |
MKKILAICGIELSLIFKKPQNYLIMFAAPLLLTFVFGSMLSGNDDKVRLAIVDQDDTILSQHYIRQLKAHDDMYVFENMSESKASEKLKQKKIAGIIVISRSFQTQLEKGKHPELIFRHGPELSEAPMVKQYAESALATLNIQVTAAKTASQTAGENWKAAYKTVFAKKHEDIVPAVTRQTLSDKKEGAEASDTASRAAGFSILFVMLTMMGAAGTILEARKNGVWSRLLTASVSRAEIGAGYVLSFFVIGWIQFGILLLSTHWLFGINWGNPAAVIVLVSLFLLTVVGIGLMIAANVRTPEQQLAFGNLFVIATCMVSGMYWPIDIEPKFMQSIAEFLPQKWAMSGLTEIIANGARVTDILGICGILLAFAAITFAAGLKALRA |
| Enzyme Length |
385 |
| Uniprot Accession Number |
P94442 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Required for resistance to linearmycins, a family of antibiotic-specialized metabolites produced by some streptomycetes (PubMed:26647299, PubMed:28461449). Part of the ABC transporter complex LnrLMN that probably facilitates linearmycin removal from the membrane. Responsible for the translocation of the substrate across the membrane (PubMed:28461449). Also mediates KinC-dependent biofilm morphology (PubMed:28461449). {ECO:0000269|PubMed:26647299, ECO:0000269|PubMed:28461449}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Domain (1); Transmembrane (6) |
| Keywords |
Cell membrane;Membrane;Reference proteome;Transmembrane;Transmembrane helix;Transport |
| Interact With |
|
| Induction |
INDUCTION: Induced in response to linearmycins and other polyenes via the two-component regulatory system LnrJ/LnrK. {ECO:0000269|PubMed:28461449}. |
| Subcellular Location |
SUBCELLULAR LOCATION: Cell membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000255}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
42,084 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|