| IED ID | IndEnz0005000188 |
| Enzyme Type ID | lipase000188 |
| Protein Name |
Lipase chaperone Lipase activator protein Lipase foldase Lipase helper protein Lipase modulator |
| Gene Name | lifO lipB VC_A0222 |
| Organism | Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Vibrionales Vibrionaceae Vibrio Vibrio cholerae Vibrio cholerae O1 Vibrio cholerae O1 biovar El Tor Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) |
| Enzyme Sequence | MKKIAWSLGILVTIGALCAIVWPSWYPSRPLVTTPSQADIQADQSSPRDLLEYFLSGLGETSLPVIQQQVQRYEQENQGLLIDSSLFAQYVQYKAALSELTLPQASGGLSTQEWWQLHQSLLDLQARYFSAEQQALFAEENRLRELAIEKRRIYEQYGQSEEAQRAWQALLLDQPDFIQRSEATAQLLPQLTQAGQGDTQQRYLARVALVGEQGAQRLAELDDSRATFEQQFQDYYQARAAILVRNELSASEQQTQIQQLREQHFAPEQWRRIDALERLKDNGE |
| Enzyme Length | 284 |
| Uniprot Accession Number | O07350 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: May be involved in the folding of the extracellular lipase during its passage through the periplasm. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Transmembrane (1) |
| Keywords | Cell inner membrane;Cell membrane;Chaperone;Lipid degradation;Lipid metabolism;Membrane;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell inner membrane {ECO:0000250}; Single-pass membrane protein {ECO:0000250}; Periplasmic side {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 32,561 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |