| IED ID | IndEnz0005000220 |
| Enzyme Type ID | lipase000220 |
| Protein Name |
Apolipoprotein A-II Apo-AII ApoA-II Apolipoprotein A2 Cleaved into: Proapolipoprotein A-II ProapoA-II |
| Gene Name | Apoa2 |
| Organism | Rattus norvegicus (Rat) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
| Enzyme Sequence | MKLLAMVALLVTICSLEGALVRRQAAETDVQTLFSQYLQSLTDYGKDLMEKAQPSEIQNQAKAYFQNAQERLTPFVQRTGTNLMDFLSRLMSPEEKPAPAAK |
| Enzyme Length | 102 |
| Uniprot Accession Number | P04638 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (2); Modified residue (1); Signal peptide (1) |
| Keywords | Cleavage on pair of basic residues;HDL;Lipid transport;Oxidation;Reference proteome;Secreted;Signal;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P02652}. |
| Modified Residue | MOD_RES 49; /note=Methionine sulfoxide; /evidence=ECO:0000250|UniProtKB:P02652 |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..18 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 1466661; 1537840; 1547188; 1903065; 2123716; 2504861; 3108158; |
| Motif | |
| Gene Encoded By | |
| Mass | 11,439 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |