Detail Information for IndEnz0005000246
IED ID IndEnz0005000246
Enzyme Type ID lipase000246
Protein Name Lipase chaperone
Lipase activator protein
Lipase foldase
Lipase helper protein
Lipase modulator
Gene Name lifO Bcep18194_B2172
Organism Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Taxonomic Lineage cellular organisms Bacteria Proteobacteria Betaproteobacteria Burkholderiales Burkholderiaceae Burkholderia Burkholderia cepacia complex Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Enzyme Sequence MTARGGRAPLARRAMVYGVVGLAAIAGVAMWSGASWHRGTGAASDSPDAPVAGGLAAAPPQAAVPASAGLPPSLAGSSAPRLPLDAGGHLAKSRAVRDFFDYCLTAQSDLSAAALDAFVVREIAAQLDGTVAQVEALDVWHRYRAYLDALAKLRDAGAVDKSDLGALQLALDQRASIAYRTLGDWSQPFFGAEQWRQRYDLARLKITRDPTLTDAQKAERLAALEQQMPADERAAQKRIDKQRAAIDQIAQLQKSGATPDAMRAQLTQTLGPEAAARVAQMQQDDASWQSRYTDYAAQRAQIESAGLSPQDRDAQITALRQRVFTKPGEAVRAASLDRGAGSAR
Enzyme Length 344
Uniprot Accession Number Q393T3
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: May be involved in the folding of the extracellular lipase during its passage through the periplasm. {ECO:0000255|HAMAP-Rule:MF_00790}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); Transmembrane (1)
Keywords Cell inner membrane;Cell membrane;Chaperone;Lipid degradation;Lipid metabolism;Membrane;Transmembrane;Transmembrane helix
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Cell inner membrane {ECO:0000255|HAMAP-Rule:MF_00790}; Single-pass membrane protein {ECO:0000255|HAMAP-Rule:MF_00790}; Periplasmic side {ECO:0000250}.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 36,556
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda