| IED ID | IndEnz0005000256 |
| Enzyme Type ID | lipase000256 |
| Protein Name |
Leukemia inhibitory factor LIF Differentiation-stimulating factor D factor Melanoma-derived LPL inhibitor MLPLI Emfilermin |
| Gene Name | LIF HILDA |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF |
| Enzyme Length | 202 |
| Uniprot Accession Number | P15018 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (2); Beta strand (2); Chain (1); Disulfide bond (3); Glycosylation (6); Helix (5); Signal peptide (1); Turn (1) |
| Keywords | 3D-structure;Alternative splicing;Cytokine;Direct protein sequencing;Disulfide bond;Glycoprotein;Growth factor;Pharmaceutical;Reference proteome;Secreted;Signal |
| Interact With | O60760; P40189; Q15323; P60328; P61601 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000269|PubMed:2730639 |
| Structure 3D | X-ray crystallography (3) |
| Cross Reference PDB | 1EMR; 1PVH; 2Q7N; |
| Mapped Pubmed ID | 10415057; 11104795; 11278729; 11448119; 11587067; 11811789; 11855863; 11960372; 12153570; 12218157; 12574225; 12579339; 12601009; 12707269; 12764151; 12807438; 14557674; 14647442; 14687743; 14715713; 15044601; 15116091; 15180980; 15341921; 15342941; 15519241; 15543003; 15670782; 15731310; 15905624; 16051226; 16205632; 16236134; 16263181; 16295654; 16341766; 16489116; 16545901; 16606674; 16648972; 16759928; 16949591; 17000646; 17054938; 17332938; 17572495; 17671691; 17681328; 17702963; 17848619; 17966612; 17979974; 18042242; 18047677; 18048043; 18258286; 18298054; 18317962; 18468598; 18492704; 18540977; 18637760; 18639869; 18684446; 18953658; 19011087; 19086053; 19124156; 19185846; 19213836; 19251277; 19255255; 19342253; 19361790; 19374770; 1940369; 1940799; 19453261; 19470478; 19495417; 19541590; 19545488; 19548631; 19550366; 19647472; 19751193; 19879916; 19913121; 19915574; 20074285; 20237496; 20396801; 20493732; 20570039; 20587610; 20597819; 20618183; 20628086; 20734064; 20851233; 21129244; 21155043; 21178106; 21191816; 21527666; 21570299; 21613225; 21726338; 21745467; 21966484; 21987111; 22142941; 22252755; 22285730; 22341639; 22436290; 22520363; 22537815; 22649064; 22698642; 22712053; 22720020; 22835519; 22851691; 22905257; 23086340; 23122949; 23541977; 23555662; 23628981; 23687977; 23729555; 23831429; 23876532; 23963683; 23967200; 24074901; 24270418; 24310780; 24690239; 24743777; 24857661; 25128195; 25179300; 25234944; 25277705; 25323535; 25514345; 25790555; 25879318; 25885043; 26187859; 26271643; 26296968; 26615902; 26716902; 26723254; 26776907; 26817395; 26817565; 26984928; 27082016; 27304912; 2779549; 28064096; 28247842; 28391028; 28432985; 28466814; 28512205; 28577574; 28729093; 28755912; 29038846; 29063331; 29269518; 29393372; 29397316; 29605252; 30213486; 30242886; 30305729; 30565675; 30611552; 30664218; 30996350; 31296870; 31586768; 31615908; 31854204; 31916327; 32045772; 32324266; 32504404; 32540613; 32827446; 32914874; 33004621; 33410420; 33555431; 33914392; 34265288; 34416362; 7594602; 7902377; 8102388; 8186324; 8301137; 8621622; 8668165; 8921438; 9013939; 9550426; |
| Motif | |
| Gene Encoded By | |
| Mass | 22,008 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |