| IED ID | IndEnz0005000287 |
| Enzyme Type ID | lipase000287 |
| Protein Name |
Tapetal oleosin GRP-17 T-oleosin GRP-17 Glycine rich protein 17 AtGRP-17 Glycine rich protein 7 AtGRP-7 Oleopollenin GRP-17 |
| Gene Name | GRP17 GRP7 At5g07530 T2I1.240 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MSEELSQKPSSAQSLSLREGRNRFPFLSLSQREGRFFPSLSLSERDGRKFSFLSMFSFLMPLLEVIKIIIASVASVIFVGFACVTLAGSAAALVVSTPVFIIFSPVLVPATIATVVLATGFTAGGSFGATALGLIMWLVKRRMGVKPKDNPPPAGLPPNSGAGAGGAQSLIKKSKAKSKGGLKAWCKKMLKSKFGGKKGKSGGGKSKFGGKGGKSEGEEGMSSGDEGMSGSEGGMSGGEGGKSKSGKGKLKAKLEKKKGMSGGSESEEGMSGSEGGMSGGGGSKSKSKKSKLKAKLGKKKGMSGGMSGSEEGMSGSEGGMSSGGGSKSKSKKSKLKAKLGKKKSMSGGMSGSEEGMSGSEGGMSGGGGGKSKSRKSKLKANLGKKKCMSGGMSGSEGGMSRSEGGISGGGMSGGSGSKHKIGGGKHGGLGGKFGKKRGMSGSGGGMSGSEGGVSGSEGSMSGGGMSGGSGSKHKIGGGKHGGLRGKFGKKRGMSGSEGGMSGSEGGMSESGMSGSGGGKHKIGGGKHKFGGGKHGGGGGHMAE |
| Enzyme Length | 543 |
| Uniprot Accession Number | Q9LY09 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Lipid-binding oleosin pollen coat protein required to mediate pollen recognition by stigma cells and subsequent pollen hydration (PubMed:10655594, PubMed:20033440, PubMed:26305561). Involved in anther tapetum development, especially for the physiology of tapetosomes (PubMed:26305561). Also implicated in the formation of pollen coat (PubMed:26305561). {ECO:0000269|PubMed:10655594, ECO:0000269|PubMed:20033440, ECO:0000269|PubMed:26305561}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (2); Chain (1); Compositional bias (2); Region (5); Repeat (29); Sequence conflict (6); Transmembrane (3) |
| Keywords | Alternative splicing;Direct protein sequencing;Extracellular matrix;Lipid droplet;Membrane;Reference proteome;Repeat;Secreted;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, extracellular space, extracellular matrix, pollen coat {ECO:0000269|PubMed:10655594, ECO:0000269|PubMed:11431566, ECO:0000269|PubMed:26305561}. Lipid droplet {ECO:0000250|UniProtKB:C3S7F0}. Membrane {ECO:0000255}; Multi-pass membrane protein {ECO:0000255}. Note=Surface of oil bodies (By similarity). Oleosins exist at a monolayer lipid/water interface (By similarity). Associated with discrete organelles (e.g. granules of 1-5 um in diameter) within the anther tapetum called tapetosomes and with a network of structures previously described as fibrils or 'strings of beads' (PubMed:26305561, PubMed:23602096). {ECO:0000250|UniProtKB:C3S7F0, ECO:0000269|PubMed:23602096, ECO:0000269|PubMed:26305561}. |
| Modified Residue | |
| Post Translational Modification | PTM: Proteolytically cleaved following anther tapetal breakdown. {ECO:0000269|PubMed:23602096, ECO:0000269|PubMed:26305561}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 14576160; 15100403; 18252252; 18433503; 23505340; 23555221; 25653662; 32374882; 32854314; |
| Motif | |
| Gene Encoded By | |
| Mass | 53,193 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |