| IED ID | IndEnz0005000321 |
| Enzyme Type ID | lipase000321 |
| Protein Name |
Apolipoprotein A-II Apo-AII ApoA-II Apolipoprotein A2 |
| Gene Name | APOA2 |
| Organism | Equus caballus (Horse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Perissodactyla (odd-toed ungulates) Equidae (horses) Equus Equus Equus caballus (Horse) |
| Enzyme Sequence | QAEESCLQNLASRYLQTVTDYGKDLVEKALAPELQAQAKAYFEKTQEQLTPLVKKIGNDLLNFFSHFIELKTQPAT |
| Enzyme Length | 76 |
| Uniprot Accession Number | P83704 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism. {ECO:0000305}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Modified residue (1) |
| Keywords | Direct protein sequencing;Disulfide bond;HDL;Lipid transport;Pyrrolidone carboxylic acid;Reference proteome;Secreted;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:15253869}. |
| Modified Residue | MOD_RES 1; /note=Pyrrolidone carboxylic acid; /evidence=ECO:0000269|PubMed:15253869 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,617 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |