| IED ID | IndEnz0005000349 |
| Enzyme Type ID | lipase000349 |
| Protein Name |
Apolipoprotein C-II Apo-CII ApoC-II Apolipoprotein C2 Cleaved into: Proapolipoprotein C-II ProapoC-II |
| Gene Name | Apoc2 |
| Organism | Neotoma lepida (Desert woodrat) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Cricetidae Neotominae Neotoma (wood rats) Neotoma lepida (Desert woodrat) |
| Enzyme Sequence | MGSRFLLALFLVLLVLGYEVQGSQQIQQDEAGSLALLNKLPESLSSYWDIAKAAVGDLYEKTYLTSVDEKLRDMYSKSSAAVSTYAGIFTDQILTLLKGE |
| Enzyme Length | 100 |
| Uniprot Accession Number | A0A1A6FVD4 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Component of chylomicrons, very low-density lipoproteins (VLDL), low-density lipoproteins (LDL), and high-density lipoproteins (HDL) in plasma. Plays an important role in lipoprotein metabolism as an activator of lipoprotein lipase. {ECO:0000250|UniProtKB:P02655}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (2); Region (2); Signal peptide (1) |
| Keywords | Chylomicron;HDL;LDL;Lipid degradation;Lipid metabolism;Lipid transport;Reference proteome;Secreted;Signal;Transport;VLDL |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P02655}. |
| Modified Residue | |
| Post Translational Modification | PTM: Proapolipoprotein C-II is synthesized as a sialic acid containing glycoprotein which is subsequently desialylated prior to its proteolytic processing. {ECO:0000250|UniProtKB:P02655}.; PTM: Proapolipoprotein C-II, the major form found in plasma undergoes proteolytic cleavage of its N-terminal hexapeptide to generate the mature form apolipoprotein C-II, which occurs as the minor form in plasma. {ECO:0000250|UniProtKB:P02655}. |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 11,001 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |