| IED ID | IndEnz0005000371 |
| Enzyme Type ID | lipase000371 |
| Protein Name |
Translational regulator CsrA Carbon storage regulator Global translational regulatory protein RsmA |
| Gene Name | csrA rsmA PA0905 |
| Organism | Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas aeruginosa group Pseudomonas aeruginosa Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) |
| Enzyme Sequence | MLILTRRVGETLMVGDDVTVTVLGVKGNQVRIGVNAPKEVAVHREEIYQRIQKEKDQEPNH |
| Enzyme Length | 61 |
| Uniprot Accession Number | O69078 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: A key translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Mediates global changes in gene expression, shifting from rapid growth to stress survival by linking envelope stress, the stringent response and the catabolite repression systems. Usually binds in the 5'-UTR; binding at or near the Shine-Dalgarno sequence prevents ribosome-binding, repressing translation, binding elsewhere in the 5'-UTR can activate translation and/or stabilize the mRNA. Its function is antagonized by small RNA(s). {ECO:0000255|HAMAP-Rule:MF_00167}.; FUNCTION: Binds to mRNA to regulate gene activity at a post-transcriptional level (Probable). Represses expression of many toxic extracellular enzymes and compounds; decreases translation of lasI and rhlI (PubMed:11673439). Positively controls swarming motility and rhanolipid and lipase, possibly via expression of rhlA; activates transcription of the CsrA/RsmA antagonistic sRNA RsmZ (PubMed:15126453). Overexpression dramatically reduces extracellular protease, elastase (lasB) and staphyolytic (lasA) activities, decreases HCN production, decreases levels of autoinducers 3-oxo-C12-HSL (3-oxo-N-(tetrahydro-2-oxo-3-furanyl)-dodecanamide) and C4-HSL (N-butanoylhomoserine lactone), and abolishes production of cytotoxic internal lectin PA-IL (lecA) (PubMed:11673439). Control of hcn expression is post-transcriptional (PubMed:11673439). Replaces endogenous gene(s) in E.coli and P.fluorescens (PubMed:16359708). {ECO:0000269|PubMed:11673439, ECO:0000269|PubMed:15126453, ECO:0000269|PubMed:16359708}.; FUNCTION: Probably binds to and is sequestered by non-coding small RNA (sRNA) RsmZ; overexpression of rsmZ produces very similar phenotypes to deletion of rsmA, while rsmZ deletion has no phenotype (PubMed:15126453). {ECO:0000269|PubMed:15126453}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (5); Chain (1); Helix (1); Mutagenesis (2); Turn (1) |
| Keywords | 3D-structure;Activator;Cytoplasm;RNA-binding;Reference proteome;Repressor;Translation regulation |
| Interact With | |
| Induction | INDUCTION: Low levels of expression in early log phase, increases about 3-fold by stationary phase (at protein level) (PubMed:11673439). {ECO:0000269|PubMed:11673439}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|HAMAP-Rule:MF_00167}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 1VPZ; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,909 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |