Detail Information for IndEnz0005000376
IED ID IndEnz0005000376
Enzyme Type ID lipase000376
Protein Name Lipase lipl-3
EC 3.1.1.-
Lipase-like 3
Gene Name lipl-3 R11G11.14
Organism Caenorhabditis elegans
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans
Enzyme Sequence MCSSLCALLLVILAVHNVHAKSDPELHMTTPQIIERWGYPAMIYSVTTDDGYILELHRIPHGKTNVTWPNGKQPVVFMQHGLLCASTDWTMNLPEQSAAFIFADAGFDVWLGNMRGNTYSMKHKNLKASHSDFWEWSWDEMATYDLPAMIDKVLEVTGQESLYYMGHSQGTLTMFSHLSKDDGIFAKKIKKFFALAPVGSVKDIKGFLSFFAHYFSLEFDGWFDVFGAGEFLPNNWAMKLAAKDICGGLKIESDLCDNVCFLIAGPESDQWNSTRVPVYASHDPAGTATQNIVHWIQMVRHGGVPAYDWGSKENKKKYGQANPPEYDFTAIKGTQIYLYWSDADWLADKTDITNYLLTRLNPAIIAQNNYFTDYNHFDFVFGLRAPNDIYLPIVDICTKDYNGK
Enzyme Length 404
Uniprot Accession Number O16956
Absorption
Active Site ACT_SITE 168; /note=Nucleophile; /evidence=ECO:0000255|PIRSR:PIRSR000862-1; ACT_SITE 344; /note=Charge relay system; /evidence=ECO:0000255|PIRSR:PIRSR000862-1; ACT_SITE 376; /note=Charge relay system; /evidence=ECO:0000255|PIRSR:PIRSR000862-1
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number 3.1.1.-
Enzyme Function FUNCTION: Lipase that, together with lipl-1, plays a role in the response to nutrient deprivation by controlling lipid metabolism (PubMed:23604316). Specifically, involved in the breakdown of lipids during lipophagy, a process during which lipids contained in lipid droplets that have been delivered to lysosomes by autophagy are degraded (PubMed:23604316). {ECO:0000269|PubMed:23604316}.
Temperature Dependency
PH Dependency BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is acidic. {ECO:0000305|PubMed:23604316};
Pathway
nucleotide Binding
Features Active site (3); Chain (1); Glycosylation (2); Signal peptide (1)
Keywords Glycoprotein;Hydrolase;Lipid degradation;Lipid metabolism;Lysosome;Reference proteome;Secreted;Signal
Interact With
Induction INDUCTION: Up-regulated in the intestine by fasting (PubMed:23604316). Down-regulated in response to a high-glucose diet (PubMed:29113111). {ECO:0000269|PubMed:23604316, ECO:0000269|PubMed:29113111}.
Subcellular Location SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:23604316}. Lysosome lumen {ECO:0000269|PubMed:23604316}. Note=Secreted into the intestinal lumen. {ECO:0000269|PubMed:23604316}.
Modified Residue
Post Translational Modification
Signal Peptide SIGNAL 1..20; /evidence=ECO:0000255
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID 10778742; 17164286; 19343510; 20439776; 21367940; 22267497; 22286215; 22347378; 22560298; 23800452; 24884423; 25487147; 34607947; 6593563;
Motif
Gene Encoded By
Mass 45,779
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda