| IED ID | IndEnz0005000477 |
| Enzyme Type ID | lipase000477 |
| Protein Name |
Colipase Fragment |
| Gene Name | |
| Organism | Squalus acanthias (Spiny dogfish) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Chondrichthyes Elasmobranchii (elasmobranchs) Selachii (sharks) Squalomorphii Squaliformes Squalidae (dogfish sharks) Squalus Squalus acanthias (Spiny dogfish) |
| Enzyme Sequence | APERGLFLNLSAGELCVGSFQCKSSCCQRETGLSLARCA |
| Enzyme Length | 39 |
| Uniprot Accession Number | P11149 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Colipase is a cofactor of pancreatic lipase. It allows the lipase to anchor itself to the lipid-water interface. Without colipase the enzyme is washed off by bile salts, which have an inhibitory effect on the lipase. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Non-terminal residue (1) |
| Keywords | Digestion;Direct protein sequencing;Disulfide bond;Lipid degradation;Lipid metabolism;Secreted |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 4,107 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |