| IED ID | IndEnz0005000479 |
| Enzyme Type ID | lipase000479 |
| Protein Name |
Envelope phospholipase F13 EC 3.1.1.- 37 kDa protein Envelope protein F13 Palmitoylated EV membrane protein p37K |
| Gene Name | F5 |
| Organism | Vaccinia virus (strain L-IVP) (VACV) |
| Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Nucleocytoviricota Pokkesviricetes Chitovirales Poxviridae Chordopoxvirinae Orthopoxvirus Vaccinia virus Vaccinia virus (strain L-IVP) (VACV) |
| Enzyme Sequence | MWPFASVPAGAKCRLVETLPENMDFRSDHLTTFECFNEIITLAKKYIYIASFCCNPLSTTRGALIFDKLKEASEKGIKIIVLLDERGKRNLGELQSHCPDINFITVNIDKKNNVGLLLGCFWVSDDERCYVGNASFTGGSIHTIKTLGVYSDYPPLATDLRRRFDTFKAFDSAKNSWLNLCSAACCLPVSTAYHIKNPIGGVFFTDSPEHLLGYSRDLDTDVVIDKLKSAKTSIDIEHLAIVPTTRVDGNSYYWPDIYNSIIEAAINRGVKIRLLVGNWDKNDVYSMATARSLDALCVQNDLSVKVFTIQNNTKLLIVDDEYVHITSANFDGTHYQNHGFVSFNSIDKQLVSEAKKIFERDWVSSHSKSLKI |
| Enzyme Length | 372 |
| Uniprot Accession Number | P29885 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.1.- |
| Enzyme Function | FUNCTION: Major envelope protein that plays a role in the biogenesis of the viral double membrane and in egress of virus from the host cell. Produces the wrapped form of virus that is required for cell-to-cell spread. Acts as a lipase with broad specificity including phospholipase C, phospholipase A, and triacylglycerol lipase activities. {ECO:0000250|UniProtKB:P04021}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Motif (1) |
| Keywords | Host Golgi apparatus;Host endoplasmic reticulum;Host membrane;Host-virus interaction;Hydrolase;Late protein;Lipoprotein;Membrane;Palmitate;Viral budding;Viral budding via the host ESCRT complexes;Viral envelope protein;Viral release from host cell;Virion |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Virion membrane {ECO:0000250|UniProtKB:P04021}; Lipid-anchor {ECO:0000250|UniProtKB:P04021}. Host Golgi apparatus, host trans-Golgi network {ECO:0000250|UniProtKB:P04021}. Host endoplasmic reticulum membrane {ECO:0000250|UniProtKB:P04021}; Lipid-anchor {ECO:0000250|UniProtKB:P04021}; Cytoplasmic side {ECO:0000250|UniProtKB:P04021}. Note=Component of the inner side of the enveloped virion (EV) membrane. F13 is associated post-translationally with membranes. {ECO:0000250|UniProtKB:P04021}. |
| Modified Residue | |
| Post Translational Modification | PTM: Palmitoylated. {ECO:0000250}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 153..156; /note=YPPL |
| Gene Encoded By | |
| Mass | 41,797 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |