| IED ID | IndEnz0005000503 |
| Enzyme Type ID | lipase000503 |
| Protein Name |
FMRFamide-like neuropeptides 7 Cleaved into: TPMQRSSMVRF-amide 1; SPMQRSSMVRF-amide 1; SPMQRSSMVRF-amide 2; SPMQRSSMVRF-amide 3; SPMERSAMVRF-amide; SPMDRSKMVRF-amide; SSIDRASMVRL-amide; TPMQRSSMVRF-amide 2 |
| Gene Name | flp-7 F49E10.3 |
| Organism | Caenorhabditis elegans |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans |
| Enzyme Sequence | MLGSRFLLLALGLLVLVLAEESAEQQVQEPTELEKSGEQLSEEDLIDEQKRTPMQRSSMVRFGRSPMQRSSMVRFGKRSPMQRSSMVRFGKRSPMQRSSMVRFGKRSPMERSAMVRFGRSPMDRSKMVRFGRSSIDRASMVRLGKRTPMQRSSMVRFGKRSMEFEMQSNEKNIEDSE |
| Enzyme Length | 177 |
| Uniprot Accession Number | G5EEC2 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: FMRFamide-like neuropeptides (PubMed:16377032, PubMed:28128367). Stimulates serotonin-induced fat loss by binding to and activating the npr-22 receptor which leads to induction of the atgl-1 lipase and subsequent fat loss (PubMed:33078707). Together with atfs-1, negatively regulates the expression of the transcription regulator hlh-11, to promote expression of atgl-1, and thus atgl-1-dependent fat oxidation in response to mitochondrial stress (PubMed:33078707). {ECO:0000269|PubMed:16377032, ECO:0000269|PubMed:28128367, ECO:0000269|PubMed:33078707}.; FUNCTION: TPMQRSSMVRF-amide: Acts as a ligand for the npr-22 receptor in vitro. {ECO:0000269|PubMed:16377032}.; FUNCTION: SPMQRSSMVRF-amide: Acts as a ligand for the npr-22 receptor in vitro. {ECO:0000269|PubMed:16377032}.; FUNCTION: [SPMERSAMVRF-amide]: Acts as a ligand for the npr-22 receptor in vitro. {ECO:0000269|PubMed:16377032}.; FUNCTION: [SPMDRSKMVRF-amide]: Acts as a ligand for the npr-22 receptor in vitro. {ECO:0000269|PubMed:16377032}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Compositional bias (1); Modified residue (8); Peptide (8); Propeptide (2); Region (1); Signal peptide (1) |
| Keywords | Amidation;Cleavage on pair of basic residues;Neuropeptide;Reference proteome;Repeat;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:28128367}. Note=Secreted from the ASI sensory neurons in response to serotonin or octopamine. {ECO:0000269|PubMed:28128367}. |
| Modified Residue | MOD_RES 62; /note=Phenylalanine amide; /evidence=ECO:0000305|PubMed:16377032; MOD_RES 75; /note=Phenylalanine amide; /evidence=ECO:0000305|PubMed:16377032; MOD_RES 89; /note=Phenylalanine amide; /evidence=ECO:0000305|PubMed:16377032; MOD_RES 103; /note=Phenylalanine amide; /evidence=ECO:0000305|PubMed:16377032; MOD_RES 117; /note=Phenylalanine amide; /evidence=ECO:0000305|PubMed:16377032; MOD_RES 130; /note=Phenylalanine amide; /evidence=ECO:0000305|PubMed:16377032; MOD_RES 143; /note=Leucine amide; /evidence=ECO:0000305|PubMed:16377032; MOD_RES 157; /note=Phenylalanine amide; /evidence=ECO:0000305|PubMed:16377032 |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10088995; 11087928; 12657671; 15236235; 15327975; 19123269; 20501595; 22560298; 23800452; 23852451; 25487147; |
| Motif | |
| Gene Encoded By | |
| Mass | 20,513 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |