| IED ID | IndEnz0005000632 |
| Enzyme Type ID | lipase000632 |
| Protein Name |
Palmitoyl-CoA hydrolase EC 3.1.2.2 Long-chain fatty-acyl-CoA hydrolase Fragment |
| Gene Name | |
| Organism | Rattus norvegicus (Rat) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
| Enzyme Sequence | NPSSPPVVDTTNTTSYPPMCSQDAVGGQVLENIPLQEDCLYNFNTVPYIVGIIPEDIIPVAIEK |
| Enzyme Length | 64 |
| Uniprot Accession Number | P80250 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=H2O + hexadecanoyl-CoA = CoA + H(+) + hexadecanoate; Xref=Rhea:RHEA:16645, ChEBI:CHEBI:7896, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:57287, ChEBI:CHEBI:57379; EC=3.1.2.2; |
| DNA Binding | |
| EC Number | 3.1.2.2 |
| Enzyme Function | FUNCTION: Hydrolysis of a variety of CoA thioesters of long-chain fatty acids. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-terminal residue (1) |
| Keywords | Direct protein sequencing;Endoplasmic reticulum;Fatty acid metabolism;Hydrolase;Lipid metabolism;Microsome;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Microsome. Endoplasmic reticulum. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,919 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:16645 |
| Cross Reference Brenda | 3.1.2.2;3.1.2.20; |