| IED ID | IndEnz0005000644 |
| Enzyme Type ID | lipase000644 |
| Protein Name |
Putative acetyl-hydrolase LipR EC 3.1.1.- |
| Gene Name | lipR bah Rv3084 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Corynebacteriales Mycobacteriaceae Mycobacterium Mycobacterium tuberculosis complex Mycobacterium tuberculosis Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Enzyme Sequence | MNLRKNVIRSVLRGARPLFASRRLGIAGRRVLLATLTAGARAPKGTRFQRVSIAGVPVQRVQPPHAATSGTLIYLHGGAYALGSARGYRGLAAQLAAAAGMTALVPDYTRAPHAHYPVALEEMAAVYTRLLDDGLDPKTTVIAGDSAGGGLTLALAMALRDRGIQAPAALGLICPWADLAVDIEATRPALRDPLILPSMCTEWAPRYVGSSDPRLPGISPVYGDMSGLPPIVMQTAGDDPICVDADKIETACAASKTSIEHRRFAGMWHDFHLQVSLLPEARDAIADLGARLRGHLHQSQGQPRGVVK |
| Enzyme Length | 308 |
| Uniprot Accession Number | P9WK85 |
| Absorption | |
| Active Site | ACT_SITE 146; /evidence=ECO:0000250|UniProtKB:O06350; ACT_SITE 239; /evidence=ECO:0000250|UniProtKB:O06350; ACT_SITE 269; /evidence=ECO:0000250|UniProtKB:O06350 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.1.- |
| Enzyme Function | FUNCTION: Required for maintaining the appropriate mycolic acid composition and permeability of the envelope on its exposure to acidic pH. {ECO:0000269|PubMed:15937179}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Motif (1); Signal peptide (1) |
| Keywords | Hydrolase;Reference proteome;Signal |
| Interact With | |
| Induction | INDUCTION: Expression is controlled by VirS. Induced at acidic pH and in macrophages. {ECO:0000269|PubMed:14568148}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..40; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 76..78; /note=Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole; /evidence=ECO:0000250|UniProtKB:Q5NUF3 |
| Gene Encoded By | |
| Mass | 32,617 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |