| IED ID | IndEnz0005000645 |
| Enzyme Type ID | lipase000645 |
| Protein Name |
Rho-related GTP-binding protein RhoC Silica-induced gene 61 protein SIG-61 |
| Gene Name | Rhoc Arhc |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL |
| Enzyme Length | 193 |
| Uniprot Accession Number | Q62159 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Regulates apical junction formation in bronchial epithelial cells. {ECO:0000269|PubMed:20974804}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | NP_BIND 12..19; /note=GTP; /evidence=ECO:0000250; NP_BIND 59..63; /note=GTP; /evidence=ECO:0000250; NP_BIND 117..120; /note=GTP; /evidence=ECO:0000250 |
| Features | Chain (1); Lipidation (1); Modified residue (1); Motif (1); Nucleotide binding (3); Propeptide (1); Sequence conflict (1) |
| Keywords | Cell membrane;GTP-binding;Lipoprotein;Membrane;Methylation;Nucleotide-binding;Prenylation;Reference proteome |
| Interact With | |
| Induction | INDUCTION: Up-regulated in silica-treated macrophages. {ECO:0000269|PubMed:7868905}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000305}; Lipid-anchor {ECO:0000305}; Cytoplasmic side {ECO:0000305}. Cleavage furrow {ECO:0000250}. Note=Translocates to the equatorial region before furrow formation in a ECT2-dependent manner. {ECO:0000250}. |
| Modified Residue | MOD_RES 190; /note=Cysteine methyl ester; /evidence=ECO:0000250 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10559899; 11217851; 12466851; 14610273; 14871999; 15093731; 15151987; 16107613; 16470169; 16615898; 18799693; 19286565; 20697357; 21087931; 21267068; 21311561; 21454503; 21502507; 21677750; 22661927; 22985540; 25933027; 26030593; 27269051; 29088697; 29113998; 7888179; 8464478; 8543060; 9438836; |
| Motif | MOTIF 34..42; /note=Effector region; /evidence=ECO:0000255 |
| Gene Encoded By | |
| Mass | 22,006 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |