| IED ID | IndEnz0005000699 |
| Enzyme Type ID | lipase000699 |
| Protein Name |
HTH-type transcriptional regulator rot Repressor of toxins |
| Gene Name | rot SAOUHSC_01879 |
| Organism | Staphylococcus aureus (strain NCTC 8325 / PS 47) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus Staphylococcus aureus (strain NCTC 8325 / PS 47) |
| Enzyme Sequence | MHKLAHTSFGIVGMFVNTCIVAKYVIINWEMFSMKKVNNDTVFGILQLETLLGDINSIFSEIESEYKMSREEILILLTLWQKGSMTLKEMDRFVEVKPYKRTRTYNNLVELEWIYKERPVDDERTVIIHFNEKLQQEKVELLNFISDAIASRATAMQNSLNAIIAV |
| Enzyme Length | 166 |
| Uniprot Accession Number | Q9RFJ6 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 87..110; /note=H-T-H motif; /evidence=ECO:0000255 |
| EC Number | |
| Enzyme Function | FUNCTION: Global regulator with both positive and negative effects that mediates modulation of several genes involved in virulence. Negatively regulates the transcription of several known virulence factors such as lipase (geh), hemolysins (hla and hlb) and proteases (splA through splF, sspB and sspC). Positively regulates the expression of sarS and other genes including those encoding cell surface adhesins (clfB, sdrC and spa). Also, modulates the expression of genes not previously implicated in pathogenesis. {ECO:0000269|PubMed:10809700, ECO:0000269|PubMed:12511508, ECO:0000269|PubMed:14996810}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); DNA binding (1); Erroneous initiation (1); Sequence conflict (1) |
| Keywords | Activator;DNA-binding;Reference proteome;Repressor;Transcription;Transcription regulation;Virulence |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 19,371 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |