| IED ID | IndEnz0005000736 |
| Enzyme Type ID | lipase000736 |
| Protein Name |
Diglucosylglycerate octanoyltransferase DGG octanoyltransferase EC 2.3.1.273 |
| Gene Name | octT C731_2896 |
| Organism | Mycolicibacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849) (Mycobacterium hassiacum) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Corynebacteriales Mycobacteriaceae Mycolicibacterium Mycolicibacterium hassiacum Mycolicibacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849) (Mycobacterium hassiacum) |
| Enzyme Sequence | MSGRRPTLLVFCDSLSYYGPRGGLPADDPRIWPNIVASQLDWDVELIGRVGWTSRDVWWAATQDPRAWAALPRAGAVIFATGGMDSLPSPLPTALRELIRYIRPPWLRRRVRDLYGWLQPRLSPVSRNALPPHLTAEYLEMTRGAIDFNRPGIPVVAALPSVHIADSYGRAHHGREATARAITEWARQHGVVLVDLKAAVADQVLNGRGNPDGIHWNFEAHQAVAELMLKALAEAGVPCR |
| Enzyme Length | 240 |
| Uniprot Accession Number | K5BJH8 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=(2R)-2-O-[alpha-D-glucopyranosyl-(1->6)-alpha-D-glucopyranosyl]-glycerate + octanoyl-CoA = (2R)-2-O-[6-O-octanoyl-alpha-D-glucopyranosyl-(1->6)-alpha-D-glucopyranosyl]-glycerate + CoA; Xref=Rhea:RHEA:56868, ChEBI:CHEBI:57287, ChEBI:CHEBI:57386, ChEBI:CHEBI:141056, ChEBI:CHEBI:141058; EC=2.3.1.273; Evidence={ECO:0000269|PubMed:26324178}; |
| DNA Binding | |
| EC Number | 2.3.1.273 |
| Enzyme Function | FUNCTION: Sugar octanoyltransferase likely involved in the biosynthesis of mycobacterial methylglucose lipopolysaccharide (MGLP). Catalyzes the transfer of an octanoyl group from octanoyl-CoA to the C6 OH of the second glucose in diglucosylglycerate (DGG). Can also use hexanoyl-CoA as acyl donor in vitro. DGG is the preferred acceptor, but to a lesser extent, GG (glucosylglycerate) can be used as substrate. DGG and GG are the two earliest intermediates in MGLP biosynthesis. {ECO:0000269|PubMed:26324178}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 45 degrees Celsius. Activity sharply decreases above this temperature. {ECO:0000269|PubMed:26324178}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 7.0-8.5. {ECO:0000269|PubMed:26324178}; |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1) |
| Keywords | Acyltransferase;Reference proteome;Transferase |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 26,579 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=9.5 mM for diglucosylglycerate (at 37 degrees Celsius) {ECO:0000269|PubMed:26324178}; KM=6.6 mM for glucosylglycerate (at 37 degrees Celsius) {ECO:0000269|PubMed:26324178}; KM=0.06 mM for octanoyl-CoA (when DGG is used as cosubstrate, at 37 degrees Celsius) {ECO:0000269|PubMed:26324178}; KM=0.01 uM for octanoyl-CoA (when GG is used as cosubstrate, at 37 degrees Celsius) {ECO:0000269|PubMed:26324178}; KM=0.02 uM for hexanoyl-CoA (when DGG is used as cosubstrate, at 37 degrees Celsius) {ECO:0000269|PubMed:26324178}; KM=0.01 uM for hexanoyl-CoA (when GG is used as cosubstrate, at 37 degrees Celsius) {ECO:0000269|PubMed:26324178}; Vmax=134 nmol/min/mg enzyme with diglucosylglycerate and octanoyl-CoA as substrates (at 37 degrees Celsius) {ECO:0000269|PubMed:26324178}; Vmax=32 nmol/min/mg enzyme with glucosylglycerate and octanoyl-CoA as substrates (at 37 degrees Celsius) {ECO:0000269|PubMed:26324178}; Vmax=41 nmol/min/mg enzyme with diglucosylglycerate and hexanoyl-CoA as substrates (at 37 degrees Celsius) {ECO:0000269|PubMed:26324178}; |
| Metal Binding | |
| Rhea ID | RHEA:56868 |
| Cross Reference Brenda | 2.3.1.273; |