| IED ID | IndEnz0005000745 |
| Enzyme Type ID | lipase000745 |
| Protein Name |
Lysosomal thioesterase PPT2 homolog PPT-2 EC 3.1.2.- |
| Gene Name | Ppt2 CG4851 |
| Organism | Drosophila melanogaster (Fruit fly) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Diptera Brachycera Muscomorpha Eremoneura Cyclorrhapha Schizophora Acalyptratae Ephydroidea Drosophilidae (pomace flies) Drosophilinae Drosophilini Drosophila (fruit flies) Sophophora melanogaster group melanogaster subgroup Drosophila melanogaster (Fruit fly) |
| Enzyme Sequence | MRLRLQVLVALLTCSSISVSLAYKPVVILHGILSGAESMASLVREIEEFHPGTIVYNCDKFNGWYSLENAWRQVDQVRDYLNEVGKLHPEGIIVLGYSQGGLLARAAIQSLPEHNVKTFISLSSPQAGQYGTSFLHLIFPDLAAKTAFELFYSRVGQHTSVGGYWNDPQRQDLYLKYSEFLPLINNEKKTSNSTSFKMGMVRLNKLVMIGGPNDDVITPWQSSHFGYFDENMDVIPFIRRPIFTSDSIGIRTLQEAGKLIIVVKPHVHHLAWHTRRDVIHEVIFPYLD |
| Enzyme Length | 288 |
| Uniprot Accession Number | Q9VKH6 |
| Absorption | |
| Active Site | ACT_SITE 98; /note=Nucleophile; /evidence=ECO:0000250; ACT_SITE 214; /evidence=ECO:0000250; ACT_SITE 269; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.2.- |
| Enzyme Function | FUNCTION: Probable thioesterase removing fatty acyl groups from various substrates such as S-palmitoyl-CoA. Because of structural constraints, may be unable to remove palmitate from peptides or proteins (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Erroneous initiation (1); Glycosylation (1); Signal peptide (1) |
| Keywords | Glycoprotein;Hydrolase;Lysosome;Reference proteome;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Lysosome {ECO:0000269|PubMed:18719403}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10893249; 12909364; 15296753; 15575970; 16581772; 16815998; 20220848; 20371351; 23071443; 23754968; 23944235; 24302569; 25312911; 25532219; 26173873; 27172210; 27894253; 31722958; 33827210; |
| Motif | |
| Gene Encoded By | |
| Mass | 32,619 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |